KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415048Help
Entry
100415048         CDS       T03264                                 

Gene name
IL36G
Definition
(RefSeq) interleukin 36, gamma
  KO
K05487  interleukin 36 gamma
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100415048 (IL36G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100415048 (IL36G)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Interleukins
   100415048 (IL36G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL1
Motif
Other DBs
NCBI-GeneID: 100415048
NCBI-ProteinID: XP_017819483
Position
14
AA seq 174 aa AA seqDB search
MGLGYVEEQRLWAMSKHIIPSTLAFQPKTGHVNDLNQQVWTLQGQTLVSVPRSSSVTPVI
VTVVTCKFPEALEQGKGDPIYLGIRNPEMCLYCEEVGEQPTLLLKEQKIMDLYDQPKPMK
PFLFYCLKTGRTSTLESVAFPGWFIASSNRDQPIFLTSELGTSHNTAFELDIKD
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgggctatgtggaggagcaaaggctttgggctatgtccaaacacatcattcca
tctacattggcattccaacctaagactgggcatgttaacgatttgaatcagcaagtgtgg
acccttcagggtcagacccttgtatcagttccaaggagtagcagtgtgactccagtcatt
gtcactgttgtcacatgcaagtttccagaggctctcgagcaaggcaaaggggatcccatt
tatttgggaatccggaatccagaaatgtgtctgtattgtgaggaggttggagaacagccc
acgttgctgctaaaagagcagaagatcatggatctgtatgaccaacccaagcccatgaaa
cctttccttttctattgtctcaagactggtaggacctccacccttgagtctgtggccttc
ccgggctggttcattgcctcctccaacagagaccagcccattttcctgacttcagaactt
gggacgtcacacaacactgcctttgaattagatataaaggactga

DBGET integrated database retrieval system