KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415095Help
Entry
100415095         CDS       T03264                                 

Gene name
MMP9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04915  Estrogen signaling pathway
cjc04926  Relaxin signaling pathway
cjc05161  Hepatitis B
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05215  Prostate cancer
cjc05219  Bladder cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100415095 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100415095 (MMP9)
   04670 Leukocyte transendothelial migration
    100415095 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100415095 (MMP9)
   04926 Relaxin signaling pathway
    100415095 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415095 (MMP9)
   05202 Transcriptional misregulation in cancer
    100415095 (MMP9)
   05206 MicroRNAs in cancer
    100415095 (MMP9)
   05205 Proteoglycans in cancer
    100415095 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    100415095 (MMP9)
   05215 Prostate cancer
    100415095 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100415095 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100415095 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100415095 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100415095 (MMP9)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     100415095 (MMP9)
Peptidases [BR:cjc01002]
 Metallo Peptidases
  Family M10
   100415095 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_3 Reprolysin_4 DUF4953
Motif
Other DBs
NCBI-GeneID: 100415095
NCBI-ProteinID: XP_002747652
Ensembl: ENSCJAG00000017207
UniProt: U3E964
Position
5
AA seq 703 aa AA seqDB search
MSLWQPLVLALLALGCCSAAPQRRQPTRVVFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGKFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSQDADIVILFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTQFGNADGAACHFPFTFEGRS
YYACTTDGRSDGVPWCSTTANYDNDGRFGFCPSERLYTQDGNGDGKPCQFPFIFQGQSYS
DCTTDGRSDGYRWCATTSNYDQDKLYGFCPTRADSTVIGGNSAGQPCVFPFTFLGKEYSS
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEPPLHKDDVKGIQHLYGSRPEPEPQPPTTTTPQPTAPPTVCPTGPPTVRPSER
PTGPPSAGPTGPPTAGPSAATTVPLDPVDNACNVNIFDAIAEIGNQLYFFKDGRYWRFSE
GRGSRPQGPFPIADTWPALPRKLDSAFEEPLSKKLFFFSGRQVWVYTGAKVLGPRRLDKL
GLGADVAQVTGALPRGSGKMLLFSGRRVWRFDVKAQMVDPRSASEVYQIFPGVPLDTHDV
FQYREKAYFCQDRFYWRVSSRNEVNQVDQVGYVTYDILQCPED
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggcactcctggcactgggctgctgctctgctgcc
ccccaacggcgccagcctacccgagtggtcttccctggagacctgagaaccaatctcact
gacaggcagctggcagaggaatatctgtaccgctatggttacactcgggtggcagagatg
cgtggggagtcgaagtctctggggcctgccctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggacagcgccacgctgaaggccatgcggaccccacggtgcggg
gtcccagacctgggcaagtttcaaacctttgagggcgacctcaagtggcaccaccacaac
atcacttattggatccaaaactactctgaggacttgccgcgggcggtgattgacgacgcc
tttgcccgagccttcgcgctgtggagcgcggtgacgccactcaccttcactcgtgtgtac
agccaggacgcagacatcgtcatcctgtttggtgttgcagagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgaagagttgtggacgctgggcaagggtgtcgtggttccaact
cagtttggaaacgcagatggcgccgcctgccacttccccttcaccttcgagggccgctcc
tactatgcctgcaccaccgacggtcgctccgacggcgtgccctggtgcagtaccacggcc
aactacgacaacgacggccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatggggacgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gactgcaccacggacggtcgctcggacggctaccgctggtgcgccaccacctccaactat
gaccaggacaagctctacggcttctgccccacccgagccgactctacagtgatcgggggc
aactcggcggggcagccgtgcgtcttccccttcaccttcctgggtaaggagtactcatct
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctactacctcgaactttgac
agcgacaagaagtggggcttctgcccagaccaaggatacagtctgttcctcgtggcggcg
cacgagtttggccatgcgctgggcttagatcactcctcagtgccggaggcgctcatgtac
cccatgtaccgcttcactgaggagccccctttgcataaggacgacgtgaaaggcatccag
cacctctatggttctcgccctgaacctgagccacagcctccgaccaccactacaccgcag
cccacggctccccctacggtctgccccaccggaccccccactgtccgaccctcagagcgc
cccacaggtcccccctcagccggccccacaggtcccccaactgctggcccttctgcggcc
actactgtgcctttggatccggtggacaatgcctgcaatgtgaacatcttcgacgccatc
gcggagattgggaaccagctatatttcttcaaggatgggaggtactggcgattctctgag
ggcaggggaagccggccacagggccccttccctatcgccgacacgtggcccgccctgccc
cgcaagctggactcagcctttgaggagccgctctccaagaagcttttcttcttctctggg
cgccaggtgtgggtgtacacaggcgcgaaggtgctgggcccgaggcgcttggacaagctg
ggcctgggcgccgacgtggcccaggtgaccggggccctcccgcgcggctcggggaagatg
ctgctgttcagcgggaggcgcgtctggaggttcgacgtgaaggcgcagatggtggatccc
cggagcgccagcgaggtgtaccagatattccccggagtgcccttggacacgcatgacgtc
ttccagtaccgagagaaagcctatttctgccaggaccgtttctactggcgtgtcagttcc
cggaatgaggtgaaccaggtggaccaagtgggctacgtgacctatgacatcctgcagtgc
cctgaggactag

DBGET integrated database retrieval system