KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415141
Entry
100415141         CDS       T03264                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00230  Purine metabolism
cjc01100  Metabolic pathways
cjc01522  Endocrine resistance
cjc04015  Rap1 signaling pathway
cjc04020  Calcium signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04114  Oocyte meiosis
cjc04211  Longevity regulating pathway
cjc04213  Longevity regulating pathway - multiple species
cjc04261  Adrenergic signaling in cardiomyocytes
cjc04270  Vascular smooth muscle contraction
cjc04371  Apelin signaling pathway
cjc04540  Gap junction
cjc04611  Platelet activation
cjc04713  Circadian entrainment
cjc04714  Thermogenesis
cjc04723  Retrograde endocannabinoid signaling
cjc04724  Glutamatergic synapse
cjc04725  Cholinergic synapse
cjc04727  GABAergic synapse
cjc04742  Taste transduction
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04911  Insulin secretion
cjc04912  GnRH signaling pathway
cjc04913  Ovarian steroidogenesis
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04918  Thyroid hormone synthesis
cjc04921  Oxytocin signaling pathway
cjc04923  Regulation of lipolysis in adipocytes
cjc04925  Aldosterone synthesis and secretion
cjc04926  Relaxin signaling pathway
cjc04927  Cortisol synthesis and secretion
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc04935  Growth hormone synthesis, secretion and action
cjc04970  Salivary secretion
cjc04971  Gastric acid secretion
cjc04972  Pancreatic secretion
cjc04976  Bile secretion
cjc05032  Morphine addiction
cjc05163  Human cytomegalovirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05200  Pathways in cancer
cjc05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100415141 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100415141 (ADCY4)
   04371 Apelin signaling pathway
    100415141 (ADCY4)
   04020 Calcium signaling pathway
    100415141 (ADCY4)
   04072 Phospholipase D signaling pathway
    100415141 (ADCY4)
   04024 cAMP signaling pathway
    100415141 (ADCY4)
   04022 cGMP-PKG signaling pathway
    100415141 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100415141 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100415141 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100415141 (ADCY4)
   04062 Chemokine signaling pathway
    100415141 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    100415141 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    100415141 (ADCY4)
   04912 GnRH signaling pathway
    100415141 (ADCY4)
   04913 Ovarian steroidogenesis
    100415141 (ADCY4)
   04915 Estrogen signaling pathway
    100415141 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    100415141 (ADCY4)
   04921 Oxytocin signaling pathway
    100415141 (ADCY4)
   04926 Relaxin signaling pathway
    100415141 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    100415141 (ADCY4)
   04918 Thyroid hormone synthesis
    100415141 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    100415141 (ADCY4)
   04916 Melanogenesis
    100415141 (ADCY4)
   04925 Aldosterone synthesis and secretion
    100415141 (ADCY4)
   04927 Cortisol synthesis and secretion
    100415141 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100415141 (ADCY4)
   04270 Vascular smooth muscle contraction
    100415141 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    100415141 (ADCY4)
   04971 Gastric acid secretion
    100415141 (ADCY4)
   04972 Pancreatic secretion
    100415141 (ADCY4)
   04976 Bile secretion
    100415141 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    100415141 (ADCY4)
   04727 GABAergic synapse
    100415141 (ADCY4)
   04725 Cholinergic synapse
    100415141 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    100415141 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    100415141 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    100415141 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    100415141 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    100415141 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100415141 (ADCY4)
   04714 Thermogenesis
    100415141 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415141 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    100415141 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    100415141 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100415141 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415141 (ADCY4)
   05163 Human cytomegalovirus infection
    100415141 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100415141 (ADCY4)
Enzymes [BR:cjc01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     100415141 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 100415141
NCBI-ProteinID: XP_017832520
Ensembl: ENSCJAG00000006470
UniProt: F7GTG2
Position
10
AA seq 1077 aa
MARLFSLRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELASDPS
FLTTVMCALGGFSLLLGLASREQRLQRWTRPLSGVVWAALLALGHAFLFTGGVVSAWDQV
SYFVFVIFTVYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVLGVYHKALMERALRATFREALSSLYSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTARGLLSSLEGSKMRPSLLMTR
YLESWGAAKPFAHLSHVDSPVSTSTPLPEKALASFSPQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSALPAFKYYEACTFLVFLSNFV
IQVLVTNRPPALAITYSITFLLFLLLLFVCFSEDLMRCVLKGPKLLHWLPALSGLVATRP
GLRIALGTTTILLVFGTAITSLFFFPASSDCPFQALNVSSTTSNLSWELPGSLPLISVPY
SMHCCVLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSDCLITRLYLGPLDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESDINREGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcctccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgcgcg
ctcgcggcactgctcgccgtggcctgggccagcggcagggagctggcctcagacccgagc
ttcctgaccactgtgatgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgcgagcagcgactgcagcgctggacgcgacccctgtcgggcgtggtgtgggccgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctactttgtcttcgtcatcttcacggtgtatgccatgctgcccttgggcatgcgagac
gccgccgtcgcgggcctcgcctcctcactctcccatctgctggtcctcgggctgtatctc
gggccacagccggactcacggcccgcactgctgccgcagttggcagcaaacgccgtgctg
tttctatgcgggaacgtgctgggagtgtaccataaggcgctgatggagcgcgccttgcgg
gccacgttccgggaggcactcagctccctgtactcgcgacggaggctggacacggagaag
aagcaccaggaacaccttcttttgtccatcctccctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacagggatcacggccagaaagcaccaacaat
ttccacagcctgtatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacacggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagatcgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctccgggctgccactctcactgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaacttcgggcagccaccggc
gtggacatcaacatgcgtgtgggtgtgcactcaggcagcgtactctgcggagtcatcggg
ctgcagaagtggcagtatgatgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggagagtgcatatcacaggggctaccctggcccttttggcaggg
gcttacgctgtggaggatgcaggcatggaacatcgggacccctaccttcgggagctaggg
gagcctacctacctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
cgaggcttgctgtcttcgcttgagggctccaagatgcgtccatcactgctgatgacccgc
tacctggaatcctggggcgcagccaagccttttgcccacctgagccatgtcgacagcccg
gtgtccacctccacccctctcccggagaaggccctggcttccttcagcccccagtggagc
ctggatcggagccgtactccccggggactagatgatgaactggacactggggatgccaag
tttttccaggtcattgagcagctcaactcgcagaaacaatggaagcagtcaaaggacttc
aacccactgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
ctccctgccttcaaatactacgaagcctgcaccttcctggtttttctctccaacttcgtc
atccaggtgctagtgacaaacaggcccccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctttttgtctgcttctcagaggacctaatgaggtgtgtcctg
aaaggccccaagctgctgcattggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcactaccaccattctccttgtctttggcacagccattacc
agcctgttcttcttccccgcatcatcagactgccctttccaagctctcaatgtgtcctcc
acgacttccaacctctcctgggagctccctgggtctctgcctctcatcagtgtcccatac
tccatgcactgctgcgttctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcctcctgctccctcttcctgcac
tcccatgcctggctgtctgactgcctcatcacccgcctctatctgggccccttggactcc
aggccaggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggatttcctgtgg
aagaagaagctgaggcaggagcgcgaggagacagagacgatggagaacctgactcggctg
ctcttggagaatgtgctccctgcgcacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctacgaatgtgtttgtgtcctcttcgcctcagtcccg
gacttcaaggagttctactctgaatctgacatcaatcgtgagggcctagagtgtctgagg
ctgctcaatgaaataattgctgattttgatgagttgctctccaagcccaagttcagtggg
gtggagaagatcaaaaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctgggcaggatgcacaacaggatgctgagcggagctgcagccaccttggcactatggta
gagtttgccgtggccctggggtctaagctggatgtcatcaacaagcactcattcaacaac
ttccgcctgcgtgtggggttgaaccatgggccagtagtagctggagtgattggggcccag
aagccacaatatgacatttggggcaacacagtgaatgtggccagccgcatggagagcaca
ggagtccttggcaaaatccaagtgactgaggagacagcctgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
tttctgaacacagacttgacacgaactggacctccttcagcaaccctaggctga

DBGET integrated database retrieval system