KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415145Help
Entry
100415145         CDS       T03264                                 

Gene name
LGMN
Definition
(RefSeq) legumain
  KO
K01369  legumain [EC:3.4.22.34]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04142  Lysosome
cjc04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100415145 (LGMN)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100415145 (LGMN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:cjc01002]
    100415145 (LGMN)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     100415145 (LGMN)
Peptidases [BR:cjc01002]
 Cysteine Peptidases
  Family C13: legumain family
   100415145 (LGMN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 DUF2675
Motif
Other DBs
NCBI-GeneID: 100415145
NCBI-ProteinID: XP_009004716
Ensembl: ENSCJAG00000018162
Position
10
AA seq 433 aa AA seqDB search
MVWKVAVFLSVALGIGALPIDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNG
IPDEQIIVMMYDDIAYAEDNPTPGIVINRPNGTDVYKGVPKDYTGEDVTPQNFLAVLRGD
AEAVKGIGSGKVLKSGPQDHVFVYFTDHGSTGILVFPNEDLPVKDLNETIHYMYKHKMYR
KMVFYIEACESGSMMNHLPDDIDVYATTAANPRESSYACYYDEKRSTYLGDWYSVNWMED
SDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKTISTMKVMQFQGMKHKASSPISLPPVT
HLDLTPSPDVPLAIMKRKLMSTNDLEVSRQLTEEIQQHLDARHLIEKSVRKIVSLLAASE
AEVEQLLTERAPLMGHSCYQEALLHFRAHCFNWHSPMYEYALRHLYVLVNLCEKPYPLHR
IKLSMDHVCLGHS
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtttggaaagtagctgtatttctcagtgtggccctgggcattggtgctcttcccata
gatgatcctgaagatggaggcaagcactgggtggtgattgtggccggttcaaatggctgg
tataattataggcaccaggcagatgcgtgccacgcctaccagatcattcaccggaatggg
attcccgatgagcagatcatcgtgatgatgtatgatgacattgcttatgctgaagacaat
cccactccaggaattgtgatcaacaggcccaatggcaccgacgtctataagggggtcccg
aaggactacaccggagaggatgtcaccccgcaaaatttccttgccgtgctgagaggcgat
gcagaagcagtgaagggcataggatccgggaaagtcctgaagagcggcccccaggatcat
gtgttcgtttacttcactgaccatggatctactggaatactggtttttcccaatgaagat
cttccggtaaaggacctgaatgagaccatccattacatgtacaaacacaaaatgtaccga
aagatggtgttctacattgaagcctgcgagtctgggtccatgatgaaccacctgcctgat
gacatcgatgtttatgcaactactgctgccaaccccagagagtcgtcctacgcctgttac
tacgatgagaagaggtccacgtacctgggggactggtatagcgtcaactggatggaggac
tccgacgtggaagatctgacgaaagaaaccctgcacaagcagtaccacctggtaaaatcg
cacaccaacaccagccacgtcatgcaatatggaaacaaaacgatctccaccatgaaagtg
atgcagtttcagggtatgaaacacaaagccagttctcctatctccttgcctccagtcaca
caccttgacctcacccccagccctgacgtgccccttgcgatcatgaaaaggaagctgatg
agcaccaatgatctggaggtgtccaggcagctcacggaggagatccagcagcatctggat
gccaggcacctcattgagaagtcagtgcgaaagatcgtctccttgctggcagcatctgag
gcggaggtggagcagctcctgactgagagagccccactcatggggcacagctgctaccag
gaggccctgctgcacttccgggcacactgcttcaactggcactcccccatgtacgagtat
gcgttgagacatctgtacgtgctggtcaacctttgtgagaaaccgtatccgcttcacagg
ataaaattgtccatggaccatgtgtgccttggtcactcctga

DBGET integrated database retrieval system