KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415241Help
Entry
100415241         CDS       T03264                                 

Gene name
PRKCQ
Definition
(RefSeq) protein kinase C theta
  KO
K18052  novel protein kinase C theta type [EC:2.7.11.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04140  Autophagy - animal
cjc04270  Vascular smooth muscle contraction
cjc04658  Th1 and Th2 cell differentiation
cjc04659  Th17 cell differentiation
cjc04660  T cell receptor signaling pathway
cjc04750  Inflammatory mediator regulation of TRP channels
cjc04920  Adipocytokine signaling pathway
cjc04931  Insulin resistance
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100415241 (PRKCQ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100415241 (PRKCQ)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100415241 (PRKCQ)
   04658 Th1 and Th2 cell differentiation
    100415241 (PRKCQ)
   04659 Th17 cell differentiation
    100415241 (PRKCQ)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100415241 (PRKCQ)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100415241 (PRKCQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100415241 (PRKCQ)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100415241 (PRKCQ)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100415241 (PRKCQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100415241 (PRKCQ)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100415241 (PRKCQ)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100415241 (PRKCQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C Kinase-like Haspin_kinase Zf_RING Pkinase_fungal C1_2 APH zf-RING-like
Motif
Other DBs
NCBI-GeneID: 100415241
NCBI-ProteinID: XP_017829536
Ensembl: ENSCJAG00000020594
Position
7
AA seq 706 aa AA seqDB search
MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYVQKKPTMYPPWDSTF
DTHINKGRLMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEXETEGFYALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAINSRETMFHKERFKIDMPHRFKVYNYK
SPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEQIFREGPVEIGLPCPIKNEARPPCLPTPGKREPQGISWESPLDEVDKTCRLP
EPELNIEKPSLQMKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSR
ATFYAAEIILGLQFLHSKGIVYRDLKLDNILLDRDGHIKIADFGMCKENMRGDAKTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREPEKRLGVRGDIRQHPLFREINWEELERKEIDPPFRPKVKSPFD
CSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFVNPGMERLIS
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccatttcttcggattggcttgtccaactttgactgcgggtcctgccagtcttgt
cagggcgaggccgttaacccttactgtgctgtgctcgtcaaagagtacgtcgaatcagag
aacgggcagatgtatgtccagaaaaagcccaccatgtacccaccctgggatagcactttt
gatacccatatcaacaagggaagactcatgcagatcatcgtgaaaggcaaaaacgtagac
ctcatctctgaaaccaccgtggagctctactcgctggctgagaggtgcaggaagaacaac
gggaagacagaaatatggttagagctgaaacctcaaggccgaatgctcatgaatgcaaga
tactttctggaaatgagtgacacaaaggacatgagtgaanttgagacagaaggcttctat
gctttgcatcagcgccggggcgccatcaaacaggcaaaggtccaccatgtcaagtgccac
gagttcaccgccaccttcttcccacagcccacgttttgttctgtctgccacgagtttgtc
tggggcctgaacaagcagggataccagtgccgacaatgcaatgcagcaattcacaagaag
tgtattgataaagtcatagcgaagtgcacaggatccgctatcaatagccgagaaaccatg
ttccacaaggagagattcaaaattgacatgccacatagatttaaagtctacaattacaag
agcccgaccttctgtgagcactgtgggaccctgctgtggggactggcacggcaagggctc
aagtgtgacgcatgtggcatgaacgtacatcacagatgccagacaaaggtggccaacctt
tgtggcataaaccagaagctaatggctgaagcgctggccatgattgagagcacccaacag
gctcgctgcttaagagataccgaacagatcttcagagaaggtccagttgaaattggtctc
ccgtgccccatcaaaaatgaagcaaggccaccatgtttaccaacaccgggaaaaagagag
ccccagggaatctcctgggagtctccgttggatgaggtggataaaacgtgccgtcttcca
gaacctgaactgaacatagaaaaaccgtctctgcagatgaaactgaaaatcgaggatttt
atcttgcacaagatgttggggaaaggaagttttggcaaggtcttcctggcagaattcaag
aaaaccaatcaatttttcgcaataaaggccttaaagaaagatgtggtcttgatggacgat
gacgtcgagtgcacgatggtagagaagagagttctttccttggcctgggagcatccgttt
ctgacgcacatgttttgcacgttccagactaaggaaaacctcttttttgtgatggagtac
ctcaacggaggggacttaatgtaccacatccaaagctgccacaagttcgatctttccaga
gccacgttttatgctgctgaaataattcttggtctgcagttccttcattccaaaggaata
gtctacagggacctgaaactggataacatcctgttagacagagatggacacatcaaaatc
gcggattttggcatgtgcaaggagaacatgcgaggagatgccaagacgaacaccttctgc
gggacgcccgactacatcgccccggagatcttgctgggtcagaaatacaaccactctgtg
gactggtggtccttcggggttctcctctatgagatgttgatcggtcagtcccctttccac
gggcaggatgaggaggagctcttccactctatccgcatggacaatcccttttacccacgg
tggctggagaaggaggcaaaggacctgctggtgaagctctttgtgcgagaaccagagaag
aggctgggcgtgaggggagacatccgccagcaccctttgtttcgggagatcaactgggag
gaacttgaacggaaggagattgacccgccgttccggccaaaagtgaaatccccatttgac
tgcagcaatttcgacaaagagttcttgaatgagaagccccggctgtcgttcgctgacaga
gcgctcatcaacagcatggaccagaacatgttcaggaacttctccttcgttaaccctggc
atggagcggctgatatcctga

DBGET integrated database retrieval system