KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415300Help
Entry
100415300         CDS       T03264                                 

Gene name
RAF1
Definition
(RefSeq) Raf-1 proto-oncogene, serine/threonine kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01521  EGFR tyrosine kinase inhibitor resistance
cjc01522  Endocrine resistance
cjc04010  MAPK signaling pathway
cjc04012  ErbB signaling pathway
cjc04014  Ras signaling pathway
cjc04015  Rap1 signaling pathway
cjc04022  cGMP-PKG signaling pathway
cjc04024  cAMP signaling pathway
cjc04062  Chemokine signaling pathway
cjc04068  FoxO signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04072  Phospholipase D signaling pathway
cjc04140  Autophagy - animal
cjc04150  mTOR signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04218  Cellular senescence
cjc04270  Vascular smooth muscle contraction
cjc04360  Axon guidance
cjc04370  VEGF signaling pathway
cjc04371  Apelin signaling pathway
cjc04510  Focal adhesion
cjc04540  Gap junction
cjc04550  Signaling pathways regulating pluripotency of stem cells
cjc04625  C-type lectin receptor signaling pathway
cjc04630  Jak-STAT signaling pathway
cjc04650  Natural killer cell mediated cytotoxicity
cjc04660  T cell receptor signaling pathway
cjc04662  B cell receptor signaling pathway
cjc04664  Fc epsilon RI signaling pathway
cjc04666  Fc gamma R-mediated phagocytosis
cjc04720  Long-term potentiation
cjc04722  Neurotrophin signaling pathway
cjc04726  Serotonergic synapse
cjc04730  Long-term depression
cjc04810  Regulation of actin cytoskeleton
cjc04910  Insulin signaling pathway
cjc04912  GnRH signaling pathway
cjc04914  Progesterone-mediated oocyte maturation
cjc04915  Estrogen signaling pathway
cjc04916  Melanogenesis
cjc04917  Prolactin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04926  Relaxin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc05034  Alcoholism
cjc05152  Tuberculosis
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05164  Influenza A
cjc05165  Human papillomavirus infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05170  Human immunodeficiency virus 1 infection
cjc05200  Pathways in cancer
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05221  Acute myeloid leukemia
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05231  Choline metabolism in cancer
cjc05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
cjc_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100415300 (RAF1)
   04015 Rap1 signaling pathway
    100415300 (RAF1)
   04010 MAPK signaling pathway
    100415300 (RAF1)
   04012 ErbB signaling pathway
    100415300 (RAF1)
   04370 VEGF signaling pathway
    100415300 (RAF1)
   04371 Apelin signaling pathway
    100415300 (RAF1)
   04630 Jak-STAT signaling pathway
    100415300 (RAF1)
   04068 FoxO signaling pathway
    100415300 (RAF1)
   04072 Phospholipase D signaling pathway
    100415300 (RAF1)
   04071 Sphingolipid signaling pathway
    100415300 (RAF1)
   04024 cAMP signaling pathway
    100415300 (RAF1)
   04022 cGMP-PKG signaling pathway
    100415300 (RAF1)
   04151 PI3K-Akt signaling pathway
    100415300 (RAF1)
   04150 mTOR signaling pathway
    100415300 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100415300 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    100415300 (RAF1)
   04218 Cellular senescence
    100415300 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100415300 (RAF1)
   04540 Gap junction
    100415300 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100415300 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100415300 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100415300 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    100415300 (RAF1)
   04660 T cell receptor signaling pathway
    100415300 (RAF1)
   04662 B cell receptor signaling pathway
    100415300 (RAF1)
   04664 Fc epsilon RI signaling pathway
    100415300 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    100415300 (RAF1)
   04062 Chemokine signaling pathway
    100415300 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100415300 (RAF1)
   04912 GnRH signaling pathway
    100415300 (RAF1)
   04915 Estrogen signaling pathway
    100415300 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    100415300 (RAF1)
   04917 Prolactin signaling pathway
    100415300 (RAF1)
   04921 Oxytocin signaling pathway
    100415300 (RAF1)
   04926 Relaxin signaling pathway
    100415300 (RAF1)
   04919 Thyroid hormone signaling pathway
    100415300 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    100415300 (RAF1)
   04916 Melanogenesis
    100415300 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100415300 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    100415300 (RAF1)
   04720 Long-term potentiation
    100415300 (RAF1)
   04730 Long-term depression
    100415300 (RAF1)
   04722 Neurotrophin signaling pathway
    100415300 (RAF1)
  09158 Development
   04360 Axon guidance
    100415300 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415300 (RAF1)
   05206 MicroRNAs in cancer
    100415300 (RAF1)
   05205 Proteoglycans in cancer
    100415300 (RAF1)
   05230 Central carbon metabolism in cancer
    100415300 (RAF1)
   05231 Choline metabolism in cancer
    100415300 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100415300 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100415300 (RAF1)
   05212 Pancreatic cancer
    100415300 (RAF1)
   05225 Hepatocellular carcinoma
    100415300 (RAF1)
   05226 Gastric cancer
    100415300 (RAF1)
   05214 Glioma
    100415300 (RAF1)
   05221 Acute myeloid leukemia
    100415300 (RAF1)
   05220 Chronic myeloid leukemia
    100415300 (RAF1)
   05218 Melanoma
    100415300 (RAF1)
   05211 Renal cell carcinoma
    100415300 (RAF1)
   05219 Bladder cancer
    100415300 (RAF1)
   05215 Prostate cancer
    100415300 (RAF1)
   05213 Endometrial cancer
    100415300 (RAF1)
   05224 Breast cancer
    100415300 (RAF1)
   05223 Non-small cell lung cancer
    100415300 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    100415300 (RAF1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100415300 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100415300 (RAF1)
   05164 Influenza A
    100415300 (RAF1)
   05161 Hepatitis B
    100415300 (RAF1)
   05160 Hepatitis C
    100415300 (RAF1)
   05163 Human cytomegalovirus infection
    100415300 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100415300 (RAF1)
   05165 Human papillomavirus infection
    100415300 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100415300 (RAF1)
   01522 Endocrine resistance
    100415300 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100415300 (RAF1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100415300 (RAF1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100415300 (RAF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like C1_2
Motif
Other DBs
NCBI-GeneID: 100415300
NCBI-ProteinID: XP_017820594
Ensembl: ENSCJAG00000016737
UniProt: F7CJL2
Position
15
AA seq 668 aa AA seqDB search
MEHIQGAWKTISNGFGLKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLQEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPALPSLTMRRMRESVTRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNNLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKAPMPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggagcacatacagggagcttggaagacgatcagcaatggttttggactcaaagatgct
gtgtttgatggctccagctgcatctctcctacaatagttcagcagtttggttatcagcgc
cgggcatcagatgatggcaaactcacagatccttcgaagacaagcaacactatccgtgtt
ttcttgccgaacaagcaacgaacagtggtcaatgtgcgaaatggaatgagcttgcatgac
tgccttatgaaagcgctcaaggtgaggggcctgcaaccagaatgctgtgcagtgttcaga
cttctccaagaacataaaggtaaaaaagcacgcttagattggaatactgatgctgcctct
ttgattggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaac
tttgctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctc
aatggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgtttccaaattccact
gttggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtct
gttacccggatgcctgttagttctcagcacagatattctacacctcatgccttcaccttt
aacacctccagtccctcatctgaaggttccctctcccagaggcagaggtcaacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggatagcaggatgattgagaataac
aacctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctg
agcccaacaggctggtcacagcccaaagcccccatgccagcacaaagggagcgggcacca
ggatctggaacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctctttt
ggaactgtttataagggcaaatggcacggagatgttgcagtaaagatcctaaaggttgta
gacccaaccccagagcagttccaggccttcaggaatgaggtggctgttttgcgcaaaaca
cggcatgtgaacattctgcttttcatggggtacatgacaaaagacaacctggcaattgtg
acccagtggtgtgagggcagcagcctctacaaacacctgcatgtccaggagaccaagttt
cagatgttccagctaattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acagtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcag
caggttgaacaacctactggctctgttctgtggatggctccagaggtgatccgaatgcag
gataacaaccccttcagcttccagtcagatgtctactcctatggcatcgtattatatgag
ctgatgacaggggagcttccttactctcacattaacaaccgagatcagatcatcttcatg
gtgggccgagggtatgcctccccagatcttagtaagctatataaaaactgccccaaagca
atgaagaggctggtagctgactgtgtcaagaaagtaaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccagcactctctaccgaagatcaaccggagcgct
tccgagccatccttgcatcgggcagcccacactgaggatatcaatgcttgcacgctgacc
acgtccccaaggctgcctgtcttctag

DBGET integrated database retrieval system