KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415329
Entry
100415329         CDS       T03264                                 
Symbol
CCDC102A
Name
(RefSeq) coiled-coil domain containing 102A
  KO
K16759  coiled-coil domain-containing protein 102
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cjc03036]
    100415329 (CCDC102A)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    100415329 (CCDC102A)
SSDB
Motif
Pfam: Myosin_tail_1 Filament Taxilin DUF745 Crescentin NPV_P10 BRE1 ADIP Sec34 AAA_13
Other DBs
NCBI-GeneID: 100415329
NCBI-ProteinID: XP_002761056
Ensembl: ENSCJAG00000011982
UniProt: U3AX42
Position
20:complement(11532972..11556984)
AA seq 550 aa
MSHGPSPRLAESPQLSKGSLLTILGSPSPERMGPADSLPPTPPSGTPSPGPPPALPLPPA
PPLLADGDWESREELRLRELEEARARAAQMEKTMRWWSDCTANWREKWSKVRAERNRARE
EVRQLRQRLDALTKELAGARRERQEAQGECEARGRELARLRGARGTADHTREGPEPEAER
EPVRDVGSERPPGSQELELVESLLKSRPEEPEDCWEVRSVGAGGPRGSSSRQERSRLPWE
DTAATEEEASKLTALRLRLDESQKVLLKEREDKLALSRNIEKLEGELSQWKIKYEELSKT
KQEMLKQLSILKEAHQDELGRMSEDLEDELGARSSMDRKMAELRGEMERLQAENAAEWGR
RERLETEKLGLERENKKLRAQVGDLEEALARRRRQTASALDCDLRASQAALFEKNKELAD
LKHVHGKLKKQFQEKVAELAHANRRVEQHEAEVKKLRLRVEELKKELAQAEDELDEAHNQ
ARKLQRSLDEQTEQSENLQVQLEHLQSRLRRQQQNAPLFGKIRSARFGTEEAGDGASDLD
EDEDLQIQVA
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgagccacgggccgagcccccggctggccgagtctcctcagctgtccaagggcagcctc
ctgaccatcctgggcagcccgtcgccagagcgcatggggcctgccgactcgctgccgccc
acgccgcccagcggcacgccctcgccagggccgccgcccgcgctgcccctgccccccgcg
cccccgctgctggccgacggcgactgggagagccgcgaggagctgcggctgcgggagctg
gaggaggcgcgggcgcgggcggcgcagatggagaagacaatgcgctggtggtcggactgc
acggccaactggcgcgagaagtggagcaaggtgcgcgccgagcgcaaccgcgcgcgcgag
gaggtgcgccagctgcgccagcgcctggacgcgctaaccaaagagctggcaggcgcgcgg
cgcgagcgccaggaggcgcagggcgagtgcgaggcacggggccgcgagctggcgcggctg
cggggcgcccggggcaccgccgaccacacgcgcgaaggccctgagccggaggcggagcgc
gagcctgtgcgcgacgtgggatcggagaggccgccgggcagccaggaactggagctggtg
gagagcctgctgaagagcaggccggaggagcctgaggactgctgggaggtgcgtagcgtg
ggggccgggggcccacgaggcagctccagccgccaggagcgtagccggctgccctgggag
gacacagctgccacggaggaggaggcctccaagttgaccgccctgcggctacggctggat
gagtcccagaaggtgctgctcaaggagcgagaggataaactggcattgagcaggaacatt
gaaaagctggagggtgagctcagccagtggaagatcaagtatgaggaactgagcaagacc
aagcaggagatgctcaagcagctcagcatcttgaaggaggcacaccaggatgagctgggc
cgcatgtccgaggacctggaggatgaactcggtgcacgctccagcatggaccggaagatg
gccgagctgaggggcgagatggagcggcttcaggccgagaacgcagcggagtggggccgc
cgggagcggctggagacagagaagctgggcctcgagcgagagaacaagaagctgcgcgca
caggtcggggacctggaggaggcgctggcccggcggcggcggcaaacagccagtgcactg
gactgtgacctgagggccagccaggccgcgctcttcgagaagaacaaggagctggcagac
ctgaagcatgttcatggcaagctgaagaagcagttccaggagaaggtggcagagctggca
catgccaaccggcgtgtggagcagcatgaggctgaggtgaagaagctgcggctgcgggta
gaggagctcaagaaggagctggcccaggctgaggacgagctggatgaggcccacaaccag
gcacgtaagctgcagcggtcgctggacgaacagacggagcagagcgagaacctgcaagtg
cagctcgagcacctgcagtccaggctccgcaggcagcagcagaatgctcccctcttcggg
aagatccgcagtgctcgctttggcactgaggaggctggggatggagccagcgacctggat
gaggatgaggacctgcaaatccaggtggcctag

DBGET integrated database retrieval system