KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415466Help
Entry
100415466         CDS       T03264                                 

Gene name
CYBB
Definition
(RefSeq) cytochrome b-245, beta polypeptide
  KO
K21421  NADPH oxidase 2 [EC:1.-.-.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04066  HIF-1 signaling pathway
cjc04145  Phagosome
cjc04216  Ferroptosis
cjc04217  Necroptosis
cjc04621  NOD-like receptor signaling pathway
cjc04670  Leukocyte transendothelial migration
cjc04933  AGE-RAGE signaling pathway in diabetic complications
cjc05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100415466 (CYBB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100415466 (CYBB)
  09143 Cell growth and death
   04216 Ferroptosis
    100415466 (CYBB)
   04217 Necroptosis
    100415466 (CYBB)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100415466 (CYBB)
   04670 Leukocyte transendothelial migration
    100415466 (CYBB)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100415466 (CYBB)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100415466 (CYBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100415466 (CYBB)
Enzymes [BR:cjc01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     100415466 (CYBB)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Phagocytosis
   NADPH oxidase complex
    100415466 (CYBB)
 Others
  NADPH oxidases (Nox) and associated proteins
   NADPH oxidases
    100415466 (CYBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_6 Ferric_reduct FAD_binding_8 FAD_binding_6 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 100415466
NCBI-ProteinID: XP_002762815
Ensembl: ENSCJAG00000005191
UniProt: F7D530
Position
X
AA seq 570 aa AA seqDB search
MGNWAVNEGLSIFVILVWLGLNVFLFVWYYRVYAIPETFFYTRKLLGSALALARAPAACL
NFNCMLILLPVCRNLLSFLRGSSACCSTRVRRQLDRNLTFHKMVAWMIALHTAIHTIAHL
FNVEWCVNARVNNSDPYSIALSELGDRPNETYLNFARKRIKNPEGGLYLAVTLLAGITGV
VITLCLILIITSSTKTIRRSYFEVFWYTHHLFVIFFIGLAIHGAERIVRGQTAKSLKEHN
PMECENKISEWGKIQKCPIPQFAGNPPMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKV
VTHPFKTIELQMKKKGFKMEVGQYIFVKCPKVSKLEWHPFTLTSAPEEDFFSIHIRIVGD
WTEGLFNACGCDKQEFQDAWKLPKIAVDGPFGTASEDVFSYEVVMLVGAGIGVTPFASIL
KSVWYKYCNNATNLKLKKIHFYWLCRDTHAFEWFADLLQLLESQMQESNNAGFLSYNIYL
TGWDESQANHFAVHHDEEKDVITGLKQKTLYGRPNWDNEFKTIASQHPNTRIGVFLCGPE
ALAETLSKQSISNSESGPRGVHFIFNKENF
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggggaactgggctgtgaatgaagggctctccatttttgtcattctggtatggctgggg
ttgaacgtcttcctctttgtctggtattaccgggtttatgctattccagaaacatttttt
tacacacgaaaacttcttgggtcagcgttggccctggccagggcccctgcagcttgcctg
aatttcaactgcatgctgattctgttgccagtctgtcgaaatctgctgtccttcctcagg
ggttccagtgcgtgctgctcaacaagagttcgaagacaactggacaggaatctcaccttt
cataaaatggtggcatggatgattgcacttcacactgcaattcacaccattgcacatcta
tttaatgtggaatggtgtgtgaatgcccgagtcaacaattctgatccttattcaatagca
ctctctgaacttggagacaggccaaatgaaacttatctcaactttgctcgaaagagaatc
aagaaccctgaaggaggcctgtacctggctgtgaccctcttggcgggcatcactggagtt
gtcatcacactgtgcctcatattaattatcacctcctccaccaaaaccatccggaggtct
tactttgaagtcttttggtacacacatcatctctttgtgatcttcttcattggccttgcc
atccatggagctgaacgaattgtacgtgggcagacagcaaagagtttgaaagagcacaat
ccaatggagtgtgaaaacaaaatctcagaatggggaaaaatacagaaatgcccaatccct
cagtttgctgggaaccctcctatgacttggaaatggattgtaggtcccatgtttctgtat
ctctgtgagagattggtgcggttttggcgatctcaacagaaggtggtcatcaccaaggtg
gtcactcatcctttcaaaaccatcgagctgcagatgaagaagaaggggttcaagatggaa
gtgggacaatacatttttgtcaagtgccccaaggtgtccaagctggagtggcaccctttc
acactgacctctgcccccgaagaagacttctttagtatccatatccgcattgttggggac
tggacagaggggctgttcaatgcttgtggctgtgataagcaggagtttcaagatgcttgg
aaactacctaagatagctgttgatgggccctttggcactgccagtgaagatgtgttcagc
tatgaggtggtgatgttagtgggagcagggattggggtcacacccttcgcatccattctc
aagtcagtctggtataaatattgcaataacgccaccaatctgaagctcaaaaagatccac
ttctactggctgtgccgggacacacatgcctttgagtggtttgcagacctgctgcagctg
ctggagagccagatgcaggaaagtaacaatgctggcttcctcagctacaacatctacctc
actggctgggatgagtctcaggccaatcactttgctgtgcaccatgatgaggagaaagat
gtgatcacaggcctgaaacaaaagactttgtatggacggcccaactgggataacgaattc
aagacaattgcaagtcaacaccctaataccagaataggagttttcctttgtggacctgaa
gccttggctgaaactctcagtaaacagagcatctccaactctgagtctggccctcgggga
gtgcatttcattttcaacaaggaaaacttctaa

DBGET integrated database retrieval system