KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415562Help
Entry
100415562         CDS       T03264                                 

Gene name
RIPK1
Definition
(RefSeq) receptor interacting serine/threonine kinase 1
  KO
K02861  receptor-interacting serine/threonine-protein kinase 1 [EC:2.7.11.1]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04064  NF-kappa B signaling pathway
cjc04210  Apoptosis
cjc04217  Necroptosis
cjc04620  Toll-like receptor signaling pathway
cjc04621  NOD-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04668  TNF signaling pathway
cjc05160  Hepatitis C
cjc05163  Human cytomegalovirus infection
cjc05169  Epstein-Barr virus infection
cjc05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100415562 (RIPK1)
   04668 TNF signaling pathway
    100415562 (RIPK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100415562 (RIPK1)
   04217 Necroptosis
    100415562 (RIPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100415562 (RIPK1)
   04621 NOD-like receptor signaling pathway
    100415562 (RIPK1)
   04622 RIG-I-like receptor signaling pathway
    100415562 (RIPK1)
   04623 Cytosolic DNA-sensing pathway
    100415562 (RIPK1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100415562 (RIPK1)
   05160 Hepatitis C
    100415562 (RIPK1)
   05163 Human cytomegalovirus infection
    100415562 (RIPK1)
   05169 Epstein-Barr virus infection
    100415562 (RIPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cjc01001]
    100415562 (RIPK1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100415562 (RIPK1)
Protein kinases [BR:cjc01001]
 Serine/threonine kinases: TKL group
  RIPK family [OT]
   100415562 (RIPK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Death RHIM RIO1 Pkinase_fungal Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 100415562
NCBI-ProteinID: XP_002746311
Ensembl: ENSCJAG00000017707
UniProt: F7DIC8
Position
4
AA seq 670 aa AA seqDB search
MEPDISLNAIKMKSSDFLERAELDSGGFGKVSLCFHRNQGLVIMKTVYTGPKCTEHNEAL
LEEAKMMNRLRHSRVMKLLGVIIEEGNYSLVMEYMEKGNLMHVLKAEMSTPLSVKGRIIV
EIIEGMCYLHGKGVIHKDLKPENILVDDDFHIKIADLGLASCKSWSKLSKEEHNELREVD
STSKKNGGTLYYMAPEHLNDVNAKPTEKSDVYSFAIVLWVIFANKEPYENAICEQQLIMC
IKSGNRPDVDDIIEYCPREIISLMKLCWEANLEVRPTFPGIEEKFRPFYLSQLEESVEED
VKNLKKQYSNEKVVKRMQSLQLDCVALPPSRSNSATEQPGSLHSSQGFGIGPVEESWFAP
SLEHQQEENMPSLQNKLQEETNYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFA
HQRPRDNFQNAEGKGIAYSGATSHGNAVYQPSGLTGQLQVPYQNNGLYSLHGFGTRPLDQ
GTAGPRVWYGPIPSHLPSPYKSPVPETNFLGNTPTMPFSSLPLPEESIKCTIHNSSGVQI
GAYNYMEVGGMSSSLSDSINMNFKEEPASKYQDIFDNTTSLTDKHLDPIRENLGKQWKNC
ARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWLMREGIKGATVGKLAQALHQCSRIDL
LNHLVYISQN
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagacatatctttgaatgccattaagatgaaatccagtgacttcctggagagg
gcagaactggacagcggaggcttcgggaaggtgtctctgtgttttcacagaaaccaggga
ctcgtgatcatgaaaacagtgtacacagggcccaaatgtaccgagcacaatgaggccctc
ctggaggaggcgaagatgatgaacagactgagacacagccgggtgatgaagctcctaggc
gtcatcatagaggaagggaactactccctggtgatggagtacatggagaagggcaacctg
atgcacgtgctgaaagccgagatgagtactccgctttcggtaaaaggaaggatcattgtg
gaaatcattgaaggaatgtgctacttacatggaaaaggcgtgatacacaaggacctgaag
cctgaaaatatccttgttgatgatgacttccacattaagattgcagaccttggccttgct
tcctgtaagtcgtggagcaaactgtctaaagaggagcacaatgagctgagggaagtggac
agcacctccaagaagaacggcggcaccctctactacatggcacctgagcacctgaacgac
gtcaatgcaaagcccacagagaagtcggatgtgtacagctttgccatagtactttgggtg
atatttgcaaataaggagccatatgagaatgctatctgtgagcagcagttgataatgtgc
ataaaatctggcaacaggccagatgtggatgacatcattgagtactgcccaagggaaatt
atcagcctcatgaagctctgctgggaagcgaacctggaagttcggccaacatttcctggc
attgaagaaaaatttaggcctttttatttaagtcaattggaagaaagcgtagaagaggac
gtgaagaatttaaagaaacagtattcaaacgaaaaagttgtgaagaggatgcagtctctt
caactcgattgtgtggcattacctcctagcaggtcaaattcagccacagagcagcctggt
tcgctgcacagttcccagggatttgggatcggtcctgtggaggagtcctggtttgccccc
tccctggagcaccagcaggaagagaatatgcccagcctgcagaataaactccaggaggaa
actaactaccatctttatggcagccgcatggacaggcagacaaaacagcagcccagacag
aatgtggcttacaacagagaggaggaaaggagacgaagggtctcccatgacccttttgca
catcaaagacctcgtgacaattttcagaatgcagagggaaaaggcattgcttattctggt
gcaaccagtcatggtaatgcagtgtaccagccctcagggctcactggccaacttcaagta
ccatatcagaacaatggattatatagcttacatggctttggaacacgaccactggatcaa
ggaacagcaggtcccagagtttggtatgggccaattccaagtcatctgcctagtccatat
aaaagcccagtgcctgagaccaactttctaggaaacacacccaccatgcccttcagctcc
ttgccactaccagaggaatctataaaatgtaccatacacaacagtagcggtgttcagatt
ggagcctacaattatatggaggttggtgggatgagttcatcactatcagacagcataaat
atgaactttaaagaagagccagcttctaagtaccaagatatctttgataataccactagt
ctgactgataaacacctggacccaatcagggaaaatctgggaaagcaatggaaaaactgt
gcccgtaaactgggcttcacacaatctcagattgatgaaattgaccatgactatgagcga
gatggactaaaagaaaaggtttaccagatgcttcaaaagtggctgatgagggaaggcatt
aagggggccacagtggggaagctggcccaggcactccaccagtgttccaggattgacctt
ctgaaccacttggtctacatcagccagaactaa

DBGET integrated database retrieval system