KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415620Help
Entry
100415620         CDS       T03264                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04120  Ubiquitin mediated proteolysis
cjc04144  Endocytosis
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04625  C-type lectin receptor signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100415620 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100415620 (MDM2)
   04151 PI3K-Akt signaling pathway
    100415620 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100415620 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    100415620 (MDM2)
   04115 p53 signaling pathway
    100415620 (MDM2)
   04218 Cellular senescence
    100415620 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100415620 (MDM2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100415620 (MDM2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415620 (MDM2)
   05202 Transcriptional misregulation in cancer
    100415620 (MDM2)
   05206 MicroRNAs in cancer
    100415620 (MDM2)
   05205 Proteoglycans in cancer
    100415620 (MDM2)
   05203 Viral carcinogenesis
    100415620 (MDM2)
  09162 Cancer: specific types
   05214 Glioma
    100415620 (MDM2)
   05220 Chronic myeloid leukemia
    100415620 (MDM2)
   05218 Melanoma
    100415620 (MDM2)
   05219 Bladder cancer
    100415620 (MDM2)
   05215 Prostate cancer
    100415620 (MDM2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100415620 (MDM2)
   05169 Epstein-Barr virus infection
    100415620 (MDM2)
   05165 Human papillomavirus infection
    100415620 (MDM2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100415620 (MDM2)
   01522 Endocrine resistance
    100415620 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cjc04131]
    100415620 (MDM2)
   04121 Ubiquitin system [BR:cjc04121]
    100415620 (MDM2)
Enzymes [BR:cjc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100415620 (MDM2)
Membrane trafficking [BR:cjc04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100415620 (MDM2)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    100415620 (MDM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB DUF1229 zf-RING_2 DUF5509 zf-FPG_IleRS zinc_ribbon_2 DZR
Motif
Other DBs
NCBI-GeneID: 100415620
NCBI-ProteinID: XP_002752774
Ensembl: ENSCJAG00000007464
Position
9
AA seq 491 aa AA seqDB search
MCNTNMSVPTDGAVTTSQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQY
IMNKRLYDEKQQHIVYCSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVNQQESSDSGT
SVSESRCRFEGGSDQKDPVQDLQEERPSSSHLVSRPSTSSRRRAISETEENSDELSGERQ
RKRHKSDSISLSFDESLALCVIREICCERSSSSESTGTPSNPDLDAGVSEHSSDWLDQDS
VSDQFSVEFEVESLDSEDYSLSEEGQELSDEDDEVYRVTVYQAGESDTDSFEEDPEISLA
DYWKCTSCHEMNPPLPSHCNRCWALRENWLPEDKGKDKGEISEKAKLENSTQAEEGFDVP
DCKKITVNDSKEPCVEENDDKITQASQSQESEDYSQPSTSSSVIYSSQEDAKESEREETQ
DKEESMESSLPLNAIEPCVICQGRPKNGCIVHGKTGHLMACFTCAKKLKKRNKPCPVCRQ
PIQMIVLTYFP
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtacctactgatggtgctgtaaccacctcacagattcca
gcttcggaacaagagaccctggttagaccaaagccattgcttttgaagttactaaagtct
gttggtgcacaaaaagacacttatactatgaaagaggttctattttatcttggccagtat
attatgaataaacgattatatgatgagaagcaacaacatattgtatattgttcaaatgat
cttctaggagatttgtttggtgtaccaagcttctctgtgaaagaacacaggaaaatatat
accatgatctacagaaacttggtagtagtcaatcagcaggaatcttcagactcaggtaca
tctgtgagtgagagcagatgtcgctttgaaggggggagtgatcaaaaggaccctgtgcaa
gacctacaggaagagagaccttcatcttcacatttggtttctagaccatctacctcatct
agaaggagagcaattagtgagacagaagaaaattcagatgaattatctggcgaacggcaa
agaaaacgccacaaatctgatagtatttccctttcctttgatgaaagcctggctctgtgt
gtaataagggagatatgttgtgaaagaagcagtagcagtgaatctacagggacgccatcg
aatccggatctggatgctggtgtaagtgaacattcaagtgattggttggatcaggattca
gtttcagatcagtttagtgtagaatttgaagttgaatctctcgactcagaagattatagc
cttagtgaagaaggacaagaactctcagatgaagatgatgaggtatatcgagttactgtg
tatcaggcaggggagagtgatacagattcatttgaagaagatcctgaaatttccttagct
gactattggaaatgcacttcatgccatgaaatgaatcccccgcttccatcacattgtaac
agatgttgggcccttcgtgagaactggcttcctgaagataaagggaaagataaaggggag
atctctgagaaagccaaactggaaaactcaacacaagctgaagagggctttgatgttcct
gattgcaaaaaaattacagtgaatgattccaaagagccgtgtgttgaggaaaatgatgat
aaaattacacaagcctcacaatcccaagaaagtgaggactattctcagccgtcaacttct
agtagcgttatttatagcagccaagaagatgcgaaagagtctgaaagggaagaaacacag
gacaaagaagaaagtatggaatctagtttgccccttaatgccattgaaccttgtgtgatt
tgtcaaggtcgacctaaaaatggttgcattgtccatggcaaaacgggacatcttatggcc
tgctttacatgtgcaaagaagctaaagaaaaggaataagccctgcccagtatgtagacaa
ccaattcaaatgattgtgctaacttatttcccctag

DBGET integrated database retrieval system