KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100415710Help
Entry
100415710         CDS       T03264                                 

Gene name
TP53
Definition
(RefSeq) tumor protein p53
  KO
K04451  tumor protein p53
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04010  MAPK signaling pathway
cjc04071  Sphingolipid signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04137  Mitophagy - animal
cjc04151  PI3K-Akt signaling pathway
cjc04210  Apoptosis
cjc04211  Longevity regulating pathway
cjc04216  Ferroptosis
cjc04218  Cellular senescence
cjc04310  Wnt signaling pathway
cjc04722  Neurotrophin signaling pathway
cjc04919  Thyroid hormone signaling pathway
cjc05014  Amyotrophic lateral sclerosis (ALS)
cjc05016  Huntington disease
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05162  Measles
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05168  Herpes simplex virus 1 infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
cjc05230  Central carbon metabolism in cancer
cjc05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100415710 (TP53)
   04310 Wnt signaling pathway
    100415710 (TP53)
   04071 Sphingolipid signaling pathway
    100415710 (TP53)
   04151 PI3K-Akt signaling pathway
    100415710 (TP53)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100415710 (TP53)
  09143 Cell growth and death
   04110 Cell cycle
    100415710 (TP53)
   04210 Apoptosis
    100415710 (TP53)
   04216 Ferroptosis
    100415710 (TP53)
   04115 p53 signaling pathway
    100415710 (TP53)
   04218 Cellular senescence
    100415710 (TP53)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100415710 (TP53)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100415710 (TP53)
  09149 Aging
   04211 Longevity regulating pathway
    100415710 (TP53)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100415710 (TP53)
   05202 Transcriptional misregulation in cancer
    100415710 (TP53)
   05206 MicroRNAs in cancer
    100415710 (TP53)
   05205 Proteoglycans in cancer
    100415710 (TP53)
   05203 Viral carcinogenesis
    100415710 (TP53)
   05230 Central carbon metabolism in cancer
    100415710 (TP53)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100415710 (TP53)
   05212 Pancreatic cancer
    100415710 (TP53)
   05225 Hepatocellular carcinoma
    100415710 (TP53)
   05226 Gastric cancer
    100415710 (TP53)
   05214 Glioma
    100415710 (TP53)
   05216 Thyroid cancer
    100415710 (TP53)
   05220 Chronic myeloid leukemia
    100415710 (TP53)
   05217 Basal cell carcinoma
    100415710 (TP53)
   05218 Melanoma
    100415710 (TP53)
   05219 Bladder cancer
    100415710 (TP53)
   05215 Prostate cancer
    100415710 (TP53)
   05213 Endometrial cancer
    100415710 (TP53)
   05224 Breast cancer
    100415710 (TP53)
   05222 Small cell lung cancer
    100415710 (TP53)
   05223 Non-small cell lung cancer
    100415710 (TP53)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    100415710 (TP53)
   05016 Huntington disease
    100415710 (TP53)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100415710 (TP53)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100415710 (TP53)
   05162 Measles
    100415710 (TP53)
   05161 Hepatitis B
    100415710 (TP53)
   05160 Hepatitis C
    100415710 (TP53)
   05168 Herpes simplex virus 1 infection
    100415710 (TP53)
   05163 Human cytomegalovirus infection
    100415710 (TP53)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100415710 (TP53)
   05169 Epstein-Barr virus infection
    100415710 (TP53)
   05165 Human papillomavirus infection
    100415710 (TP53)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100415710 (TP53)
   01522 Endocrine resistance
    100415710 (TP53)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cjc03000]
    100415710 (TP53)
   03036 Chromosome and associated proteins [BR:cjc03036]
    100415710 (TP53)
   03400 DNA repair and recombination proteins [BR:cjc03400]
    100415710 (TP53)
Transcription factors [BR:cjc03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   p53
    100415710 (TP53)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     100415710 (TP53)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    100415710 (TP53)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: P53 P53_tetramer P53_TAD TAD2
Motif
Other DBs
NCBI-GeneID: 100415710
NCBI-ProteinID: XP_002747994
Ensembl: ENSCJAG00000014978
UniProt: F7GNX0
Position
5
AA seq 395 aa AA seqDB search
MEEPQSDLSIEPPLSQETFSDLWKLLPENNILSSSLSQPVDDLMLSPDDIDIAQWLSQDP
VPDEAPTVSEAPPAMAQAPAAPTLVAPTPAPSWPLSSSVPSQKTYHGDYGFRLGFLHSGT
AKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPRGTRVRAMAIYKQSQHMTEVVRRCPH
HERCSDSDGLAPPQHLIRVEGNLHVEYLDDKNTFRHSVVVPYEPPEVGSDCTTIHYNYMC
NSSCMGGMNRRPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENFRKKGEPCLD
LPPGSTKRAMPNSTSSSPQPKKKPLDGEYFTLQIHGRERFEMFRELNEALELKDAQAGKE
PGGSRAHSNHLKSKKGQCTSRHKKLMVKREGPDSD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccgcagtcagatctcagcatcgagcccccgctgagtcaggaaacattttca
gacctatggaaactacttcctgaaaacaacattctgtcctcctcgctgtcccaaccggtg
gatgatttgatgctatccccagatgacattgacattgcacaatggttgagtcaagacccg
gttccagatgaagctcccacagtttcagaggctcctcccgccatggcccaggcaccggca
gctcctacattagtggcccccacaccagccccctcctggcccctgtcatcctctgtccct
tcccagaaaacctaccatggtgactacggtttccgtctgggcttcttgcattctgggaca
gccaagtctgtgacttgcacgtactcccctgccctcaacaagatgttttgccagctggcc
aaaacctgccccgtgcagctgtgggttgattccacacccccacgtggcacccgcgtccgc
gccatggccatctacaagcagtcacagcacatgacggaggtcgtgaggcgctgcccccac
catgagcgctgctcagatagcgatggtctggcccctcctcagcatcttatccgagtggaa
ggaaatttacatgtggaatatttggatgacaaaaacacttttcgacatagtgtggtggtg
ccctatgagccgcctgaggtcggctctgattgtaccaccattcactacaactacatgtgt
aacagttcctgcatgggcggcatgaaccggaggcccatcctcaccatcatcactctggaa
gactccagtggtaatctgctgggacggaacagctttgaggtgcgcgtttgtgcctgtcct
gggagagaccggcgcacagaggaagagaatttccgtaagaaaggggagccttgcctcgat
ctgccccctgggagcactaagcgagcaatgcccaatagcacgagctcctctccccagcca
aagaagaagccactggatggagaatatttcacccttcagatccatgggcgtgagcgcttt
gagatgttccgagagctgaatgaggccttggaactcaaggatgcccaggctgggaaggag
ccaggggggagcagggcccactccaaccacctgaagtccaagaaggggcagtgtacctcc
cgccataaaaaactaatggtcaagagagagggacctgactcagactga

DBGET integrated database retrieval system