KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100894215Help
Entry
100894215         CDS       T03264                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin dependent kinase inhibitor 1A
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc01522  Endocrine resistance
cjc01524  Platinum drug resistance
cjc04012  ErbB signaling pathway
cjc04066  HIF-1 signaling pathway
cjc04068  FoxO signaling pathway
cjc04110  Cell cycle
cjc04115  p53 signaling pathway
cjc04151  PI3K-Akt signaling pathway
cjc04218  Cellular senescence
cjc04630  Jak-STAT signaling pathway
cjc04921  Oxytocin signaling pathway
cjc04928  Parathyroid hormone synthesis, secretion and action
cjc04934  Cushing syndrome
cjc05160  Hepatitis C
cjc05161  Hepatitis B
cjc05163  Human cytomegalovirus infection
cjc05165  Human papillomavirus infection
cjc05166  Human T-cell leukemia virus 1 infection
cjc05167  Kaposi sarcoma-associated herpesvirus infection
cjc05169  Epstein-Barr virus infection
cjc05200  Pathways in cancer
cjc05202  Transcriptional misregulation in cancer
cjc05203  Viral carcinogenesis
cjc05205  Proteoglycans in cancer
cjc05206  MicroRNAs in cancer
cjc05210  Colorectal cancer
cjc05211  Renal cell carcinoma
cjc05212  Pancreatic cancer
cjc05213  Endometrial cancer
cjc05214  Glioma
cjc05215  Prostate cancer
cjc05216  Thyroid cancer
cjc05217  Basal cell carcinoma
cjc05218  Melanoma
cjc05219  Bladder cancer
cjc05220  Chronic myeloid leukemia
cjc05222  Small cell lung cancer
cjc05223  Non-small cell lung cancer
cjc05224  Breast cancer
cjc05225  Hepatocellular carcinoma
cjc05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100894215 (CDKN1A)
   04630 Jak-STAT signaling pathway
    100894215 (CDKN1A)
   04066 HIF-1 signaling pathway
    100894215 (CDKN1A)
   04068 FoxO signaling pathway
    100894215 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100894215 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100894215 (CDKN1A)
   04115 p53 signaling pathway
    100894215 (CDKN1A)
   04218 Cellular senescence
    100894215 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100894215 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100894215 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100894215 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100894215 (CDKN1A)
   05206 MicroRNAs in cancer
    100894215 (CDKN1A)
   05205 Proteoglycans in cancer
    100894215 (CDKN1A)
   05203 Viral carcinogenesis
    100894215 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100894215 (CDKN1A)
   05212 Pancreatic cancer
    100894215 (CDKN1A)
   05225 Hepatocellular carcinoma
    100894215 (CDKN1A)
   05226 Gastric cancer
    100894215 (CDKN1A)
   05214 Glioma
    100894215 (CDKN1A)
   05216 Thyroid cancer
    100894215 (CDKN1A)
   05220 Chronic myeloid leukemia
    100894215 (CDKN1A)
   05217 Basal cell carcinoma
    100894215 (CDKN1A)
   05218 Melanoma
    100894215 (CDKN1A)
   05211 Renal cell carcinoma
    100894215 (CDKN1A)
   05219 Bladder cancer
    100894215 (CDKN1A)
   05215 Prostate cancer
    100894215 (CDKN1A)
   05213 Endometrial cancer
    100894215 (CDKN1A)
   05224 Breast cancer
    100894215 (CDKN1A)
   05222 Small cell lung cancer
    100894215 (CDKN1A)
   05223 Non-small cell lung cancer
    100894215 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100894215 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100894215 (CDKN1A)
   05161 Hepatitis B
    100894215 (CDKN1A)
   05160 Hepatitis C
    100894215 (CDKN1A)
   05163 Human cytomegalovirus infection
    100894215 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100894215 (CDKN1A)
   05169 Epstein-Barr virus infection
    100894215 (CDKN1A)
   05165 Human papillomavirus infection
    100894215 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100894215 (CDKN1A)
   01522 Endocrine resistance
    100894215 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI
Motif
Other DBs
NCBI-GeneID: 100894215
NCBI-ProteinID: NP_001257652
UniProt: U3E394
Position
4
AA seq 158 aa AA seqDB search
MSEQAGDVRPNPSSSKARRCLFGPVDSEQLRRDCDALMAGCIKEARERWNFDFVTETPLE
GDFAWERVWGLGLPKICLPKGPLGGGRRPGTSPALLQGTAEEDHVDLSLSCTLMPHSGER
PEESPGGPGDSEGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaacaggctggggatgtccgtccgaacccatccagcagcaaggcccgccgctgc
ctcttcggcccagtggacagcgagcagctgagacgcgactgtgatgcactgatggcaggc
tgcatcaaggaggcccgtgagcgatggaacttcgactttgtcactgagacaccactggag
ggtgacttcgcctgggagcgtgtgtggggccttggcctgcccaagatctgccttcccaaa
gggcccctgggaggaggcaggcggcctggcacctcgcctgctctgctgcaggggacagcg
gaggaagaccacgtggacctgtcgctgtcttgcaccctaatgcctcactcaggggagcgg
cctgaggagtccccaggtggacctggagactctgagggtcgaaaacggcggcagaccagc
atgacagatttctaccactccaaacgccggctgatcttctccaagaggaagccctaa

DBGET integrated database retrieval system