KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100894965Help
Entry
100894965         CDS       T03264                                 

Gene name
CXCL10
Definition
(RefSeq) C-X-C motif chemokine ligand 10
  KO
K12671  C-X-C motif chemokine 10
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04620  Toll-like receptor signaling pathway
cjc04622  RIG-I-like receptor signaling pathway
cjc04623  Cytosolic DNA-sensing pathway
cjc04657  IL-17 signaling pathway
cjc04668  TNF signaling pathway
cjc05160  Hepatitis C
cjc05164  Influenza A
cjc05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100894965 (CXCL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100894965 (CXCL10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100894965 (CXCL10)
   04622 RIG-I-like receptor signaling pathway
    100894965 (CXCL10)
   04623 Cytosolic DNA-sensing pathway
    100894965 (CXCL10)
   04657 IL-17 signaling pathway
    100894965 (CXCL10)
   04062 Chemokine signaling pathway
    100894965 (CXCL10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100894965 (CXCL10)
   05160 Hepatitis C
    100894965 (CXCL10)
   05169 Epstein-Barr virus infection
    100894965 (CXCL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100894965 (CXCL10)
   00536 Glycosaminoglycan binding proteins [BR:cjc00536]
    100894965 (CXCL10)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100894965 (CXCL10)
Glycosaminoglycan binding proteins [BR:cjc00536]
 Heparan sulfate/Haparin
  Chemokines
   100894965 (CXCL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100894965
NCBI-ProteinID: XP_003732528
Ensembl: ENSCJAG00000014474
UniProt: A0A2R8MWC4
Position
3
AA seq 97 aa AA seqDB search
MNQTAILIFCLICLTISGTQGLPHSRTVRCNCISISKHVNPRFIETLEIIPASQSCSRVE
IIATMKNNGEKRCLNLESKAIKNLLTAVSKLRSKRSL
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaaactgccattctgattttctgccttatctgtctgactataagtggcactcaa
ggactgcctcattctagaactgtacgctgtaactgcatcagcattagtaaacatgttaat
ccaaggttcatagaaacacttgagattattcctgcaagtcaatcttgttcacgtgttgag
atcattgctacaatgaaaaacaatggtgagaagagatgcctgaatctggaatctaaggcc
atcaagaatctactgacagcagttagcaagctaaggtctaaaagatctctttga

DBGET integrated database retrieval system