KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100895453Help
Entry
100895453         CDS       T03264                                 

Gene name
CD14
Definition
(RefSeq) CD14 molecule
  KO
K04391  monocyte differentiation antigen CD14
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04010  MAPK signaling pathway
cjc04064  NF-kappa B signaling pathway
cjc04145  Phagosome
cjc04620  Toll-like receptor signaling pathway
cjc04640  Hematopoietic cell lineage
cjc05132  Salmonella infection
cjc05133  Pertussis
cjc05134  Legionellosis
cjc05146  Amoebiasis
cjc05152  Tuberculosis
cjc05202  Transcriptional misregulation in cancer
cjc05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100895453 (CD14)
   04064 NF-kappa B signaling pathway
    100895453 (CD14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100895453 (CD14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100895453 (CD14)
   04620 Toll-like receptor signaling pathway
    100895453 (CD14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100895453 (CD14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100895453 (CD14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100895453 (CD14)
   05133 Pertussis
    100895453 (CD14)
   05134 Legionellosis
    100895453 (CD14)
   05152 Tuberculosis
    100895453 (CD14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100895453 (CD14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjc04147]
    100895453 (CD14)
   04090 CD molecules [BR:cjc04090]
    100895453 (CD14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjc00537]
    100895453 (CD14)
Exosome [BR:cjc04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100895453 (CD14)
CD molecules [BR:cjc04090]
 Proteins
  100895453 (CD14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjc00537]
 Receptors
  100895453 (CD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_6
Motif
Other DBs
NCBI-GeneID: 100895453
NCBI-ProteinID: XP_008984315
Ensembl: ENSCJAG00000016545
UniProt: F7B9N7
Position
2
AA seq 375 aa AA seqDB search
MERASCLLLLLLPLVHVSATTPEPCELDDDDFRCVCNFSEPQPDWSEAFQCVAAVEVEIR
GGGRSLEPLLKRVDANADPRQYADTVKALRVRRLTVGAAKVPAQLLVGALSVLAYSRLKE
LTLEDLEITDTMPPLPLEAKGLALSSLHLRNVSWAAGRSWLAELQQWLHPGLKALSIVQA
HSLAFSCEQIRAFPDLTSLDLSDNAGLGERGLIAALCPHKFPALQNLALRNTGMETPTDV
CAALAASGVQPHSLDLSHNSLRATANPSAPRCVWSSALNSLNLSFAGLEQVPRGLPAKLS
VLDLSCNRLNRAPKRDELPKVDNLILDGNPFLVPGSALPQEGSPNSGMVPACARSTLSVG
VSGTLVVLQGVRGFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcgcgtcctgcttgttgctgctgctactgccgctggtgcacgtctctgcgacc
acgccagaaccttgtgagctggacgatgacgatttccgttgcgtttgcaacttctccgaa
cctcagcccgactggtccgaagccttccaatgtgtggctgctgtcgaggtggagatccgt
ggcggcggccgcagcctggagccacttctaaagcgcgtcgatgccaacgctgacccgcgg
cagtatgctgacacagtcaaggctctccgcgtgcggcggctcacagtgggagccgcaaag
gttcctgctcagctactggtaggcgccctgagtgtgctagcgtactcccgcctcaaggaa
ctgacgctcgaggacctagagataaccgacaccatgcctccgctgcctctggaagccaaa
gggcttgcactttccagcttgcaccttcgcaacgtgtcgtgggcagcagggcgttcctgg
ctcgcggagctgcagcagtggctccacccaggccttaaggcactaagcattgtccaagca
cactcgcttgccttttcctgcgaacagattcgcgccttcccggacctcaccagcctagac
ctgtctgacaatgctggactgggcgaacgcggactgatcgcggctctctgtccgcacaaa
ttcccagccctccagaatctagcgctgcgcaacacaggaatggagacgcccacagacgtg
tgcgctgcgctggcggcgtcaggtgtgcagccccacagcctagacctcagccacaactcg
ctgcgcgccaccgcaaaccccagcgctccaagatgcgtgtggtccagtgccctaaactcc
ctcaatctgtcgtttgctgggctggaacaggtgcctagaggactgccggccaagctcagc
gtgctcgatcttagctgcaacaggctgaacagggcgccgaagcgtgacgagttgcccaag
gtggataacctgatactggacgggaatcctttcctggtccctggaagtgccctcccccaa
gagggctcgccgaactctggcatggtcccagcctgtgcacgttcgaccctgtcggtggga
gtgtcgggaaccctggtggtgctccaaggggtccggggctttgcctaa

DBGET integrated database retrieval system