KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100896021Help
Entry
100896021         CDS       T03264                                 

Gene name
CCL11
Definition
(RefSeq) C-C motif chemokine ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04060  Cytokine-cytokine receptor interaction
cjc04062  Chemokine signaling pathway
cjc04657  IL-17 signaling pathway
cjc05310  Asthma
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100896021 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100896021 (CCL11)
   04062 Chemokine signaling pathway
    100896021 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    100896021 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:cjc04052]
    100896021 (CCL11)
Cytokines and growth factors [BR:cjc04052]
 Cytokines
  Chemokines
   100896021 (CCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 100896021
NCBI-ProteinID: XP_008995342
Ensembl: ENSCJAG00000014577
UniProt: F7I909
Position
5
AA seq 97 aa AA seqDB search
MKFSATFLWLLLIAAAFSPEVLAQPAFVPTSCCFTLANRKIPLKRLESYRRISSGRCPYN
AVVFKTKLGKDICADPKAKWVQDSMKYLDQKSLTPKP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctccgcaacatttctgtggctgctgctcatagcagctgctttcagccccgag
gtgctcgctcagccagctttcgtcccaacctcctgctgctttaccctggccaataggaag
ataccccttaagcgactggagagctacagaagaatcagcagtggcagatgtccctataat
gctgtggtcttcaagaccaaactgggcaaggatatctgtgctgaccccaaggcaaagtgg
gtgcaggattccatgaagtacctggaccaaaaatctttaactccaaagccataa

DBGET integrated database retrieval system