KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103790782Help
Entry
103790782         CDS       T03264                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103790782
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cjc03041]
    103790782
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     103790782
Spliceosome [BR:cjc03041]
 Complex C
  Other components
   Step II factors
    103790782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C
Motif
Other DBs
NCBI-GeneID: 103790782
NCBI-ProteinID: XP_017824685
Position
Un
AA seq 117 aa AA seqDB search
MQIHLTEPPGDILVFLTGQEEIDTACETLYERMKSLGPDVPELVILPVYSALPSEMRTQI
FDPAPPGSRQVVFATSIAETSLTIDGIYYVVDPGFVKQKVYNSKIGTDQLVITPISQ
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgcagatccatttaacagagccaccaggtgatatcctggtcttcctgactggtcaggaa
gagattgatactgcttgtgagaccctgtatgaaagaatgaaatccctgggacctgatgtt
ccagagttagttatcctcccagtgtactctgctcttcccagtgagatgcggacccaaatc
tttgacccagctccaccaggcagcagacaggttgtgtttgccaccagtatcgcagaaacg
tcgctgactattgatggcatctactacgtggtggacccaggattcgtgaagcagaaagtt
tacaattccaagatagggactgaccagcttgtgataacacctatttctcag

DBGET integrated database retrieval system