KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103793428
Entry
103793428         CDS       T03264                                 
Symbol
ANAPC11
Name
(RefSeq) anaphase promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc04110  Cell cycle
cjc04114  Oocyte meiosis
cjc04120  Ubiquitin mediated proteolysis
cjc04914  Progesterone-mediated oocyte maturation
cjc05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103793428 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103793428 (ANAPC11)
   04114 Oocyte meiosis
    103793428 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103793428 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103793428 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:cjc04121]
    103793428 (ANAPC11)
   03036 Chromosome and associated proteins [BR:cjc03036]
    103793428 (ANAPC11)
Ubiquitin system [BR:cjc04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     103793428 (ANAPC11)
Chromosome and associated proteins [BR:cjc03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    103793428 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 103793428
NCBI-ProteinID: XP_008996154
Ensembl: ENSCJAG00000019127
UniProt: F7I8L7
Position
5:131008039..131013092
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLHAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagattaagtgctggaatggcgtggccacttggctctgggtggccaacgat
gagaactgtggcatctgcaggatggcgtttaatggctgctgccccgactgcaaggtgccc
ggcgacgactgcccattggtgtggggccagtgctcccactgcttccacatgcactgtatc
ctcaagtggcttcacgcgcagcaggtgcagcagcactgccccatgtgtcgccaggagtgg
aagttcaaggagtga

DBGET integrated database retrieval system