KEGG   Callithrix jacchus (white-tufted-ear marmoset): 103796390Help
Entry
103796390         CDS       T03264                                 

Gene name
MUS81
Definition
(RefSeq) MUS81 structure-specific endonuclease subunit
  KO
K08991  crossover junction endonuclease MUS81 [EC:3.1.22.-]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc03440  Homologous recombination
cjc03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:cjc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    103796390 (MUS81)
   03460 Fanconi anemia pathway
    103796390 (MUS81)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjc03400]
    103796390 (MUS81)
Enzymes [BR:cjc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.-  
     103796390 (MUS81)
DNA repair and recombination proteins [BR:cjc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Other HR factors
     103796390 (MUS81)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ERCC4 HHH_8 MutL
Motif
Other DBs
NCBI-GeneID: 103796390
NCBI-ProteinID: XP_017833775
Ensembl: ENSCJAG00000001894
Position
11
AA seq 552 aa AA seqDB search
MAAPVRLGRKRPLPACPNPLFVRWLTEWRDEATRSGRRTRFVFQKALRSLRRYPLPLRSG
KEAKILQHFGDGLCRMLDERLQRHGTSGGDHTPASPSGQNSPAPQGRPAEVQDSSMPVPA
QPKVGGSGSYWPARHSGARVILLLLYQEHLNPKGHQFLTKEELLQRCAQKAPRVVPGSAR
PWPALRSLLHRNLVLRTHQPARYSLTPEGLDLAQKLAESEGLSLLNVGIRPEEPPGEETA
VPGAASAELASEAGVQQPPLELRPGEYRVLLCVDISETRGAGHRPELLRELQRLHVTHTV
RKLHVGDFVWVAQETNPRDPAASPGELVLDHIVERKRLDDLCSSIIDGRFREQKFRLKRC
GLERRVYLVEEHGSVHNLSLPESTLLQAVTNTQVIDGFFVKRTADIKESAAYLALLTRGL
QRLYQGHTLRSRPWGTPGNPESGAMPSPNPLCSLLTFSDFNAGAIKNKAQSVREVFARQL
MQVRGVSGEKAAALVDRYSTPASLLAAYDACATPKEQETLLSTIKCGRLQRNLGPALSRT
LSQLYCSYSPLT
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccagtccgcctgggtcggaagcgcccgctgcctgcctgtcccaacccgctc
ttcgttcgctggctgaccgagtggcgggacgaggcgacccgcagcggacgccgcacgcgc
ttcgtgtttcagaaggcgctgcgctccctccggcggtacccactgccgctgcgcagcggg
aaggaagctaagattctgcagcactttggtgacgggctctgccggatgttggacgagcgg
ctgcagcggcacggaacatccggcggtgaccataccccagcctcaccatctggacagaac
agtccagcaccgcaggggcgacctgcagaagtccaggactcttccatgccagttcctgcc
cagcccaaagtgggaggctctggtagctactggccagctcggcactcaggagcccgagta
atactactgctgctctaccaggagcacctgaatcctaagggccaccagttcttaaccaag
gaggaactgctgcagaggtgtgctcagaaggcccccagggtagtccctgggagtgctcga
ccctggccagccctccgctcccttctccacaggaacctggtcctcaggacacaccagcca
gccaggtactcactgaccccagagggcctggacctggcccagaagttggctgaatcagaa
ggcctgagcttgctgaatgtgggcatcaggcccgaggagccccctggggaggagacagca
gtgccaggagcagcttcagcagagcttgccagtgaagcaggggtccagcagccaccactg
gagctgaggcctggagagtacagagtactattgtgtgtggacatcagcgagacccggggg
gcggggcacaggccggagctactccgagaactacagcggctgcatgtgacccacacagtg
cgcaagctgcatgttggggattttgtgtgggtagcacaggagaccaatcctagagatcca
gcagcaagccctggggagttggtgctggaccacatcgtggagcgcaagcggctggatgac
ctgtgcagcagcatcattgacggccgcttccgggagcagaagttccggctaaagcgctgc
ggcctggagcgccgggtatacctggtggaagagcatggatcagtccacaacctcagcctt
cctgagagcacgctgctgcaggctgtcaccaacactcaggtcattgatggcttttttgtg
aagcgcacagcagacattaaggagtcagccgcctacctggccctcttgacacggggcttg
cagagactctaccagggccacaccctacgcagccgcccctggggaacccctgggaaccct
gaatcaggggccatgccctctccaaaccctctctgctcactcctcaccttcagtgacttc
aacgcaggggccatcaagaacaaggcccagtcggtgcgagaagtgtttgcccggcagctg
atgcaggtgcgcggagtgagtggggagaaggcagcagccctggtagatcgatacagcacc
cctgccagcctcctggccgcctatgatgcctgtgcaacccccaaggaacaagagacacta
ctcagcaccatcaagtgtgggcgtctgcagaggaatctggggcctgctctgagcaggact
ttgtcccagctgtactgcagctacagccccctgacctga

DBGET integrated database retrieval system