KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0276Help
Entry
JJD26997_0276     CDS       T00573                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:cjd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    JJD26997_0276
Enzymes [BR:cjd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     JJD26997_0276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABS43590
UniProt: A7H1W5
Position
252195..252797
Genome map
AA seq 200 aa AA seqDB search
MKIILATSNKHKVLELKEILKDFEIYAFDEVLTPFEIEENGKTFKENALIKARAVFNALD
EKQKKDFIALSDDSGICVDVLEGNPGIYSARFSGKGDDKSNRDKLVNEMIKKGFNQSRAH
YVAAIAMVGLMGEFSTHGTMYGKVIDTEKGENGFGYDSLFIPKGFDKTLAQLSVDEKNNI
SHRFKALELAKIILKILTKG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagattatcctagctacgagtaataagcataaggttttagaacttaaagaaatttta
aaagattttgaaatttatgcttttgatgaagttttaacgccttttgagattgaagaaaat
ggaaaaacttttaaagaaaatgctttgattaaagcaagagcagtttttaatgctttggat
gaaaagcaaaaaaaagattttatcgctttaagtgatgatagtggtatttgtgtagatgtt
ttagaaggaaatccaggaatttattctgctcgatttagcggtaagggcgatgataaaagt
aatcgtgataaacttgtcaatgaaatgataaaaaaaggttttaatcaaagcagggcacat
tatgttgctgctattgctatggtaggtttgatgggggaatttagcacgcatggaacaatg
tatggaaaagtgatagatacagaaaaaggtgaaaatggttttggctatgatagccttttt
attccaaagggttttgataaaaccttagcccagcttagcgtggatgagaagaataacatc
tctcatcgttttaaagctttagagcttgcaaaaatcattttaaagattttaacaaaagga
taa

DBGET integrated database retrieval system