KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_0974
Entry
JJD26997_0974     CDS       T00573                                 
Name
(GenBank) hypothetical protein
  KO
K12057  conjugal transfer pilus assembly protein TraF
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Brite
KEGG Orthology (KO) [BR:cjd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cjd02044]
    JJD26997_0974
Secretion system [BR:cjd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   JJD26997_0974
SSDB
Motif
Pfam: TraF PUA_2 Thioredoxin_8
Other DBs
NCBI-ProteinID: ABS43701
UniProt: A7H3K5
Position
complement(858793..859566)
AA seq 257 aa
MIKISTTILIIVCYLHASTFFGDSKRGWFYYELADNNNSQEKNETKVQKRMNADDLFIAS
IPLNNLDLLTAEEFTETFEKVRKIAIMNPTKTNVMTMQIMNKWQVDQSEKFAKVWVLNLL
ENPNLEYPEIRDDKFGRSEMFRQKQEKINNFYKAHQDDFSYVVFVSNLNKESNEKQKGIY
RSLQSDYGVNVEYVNVDERKDLISKFKLTTTPENFFVYKNSKGEAIWQRVKSGLTNKDDI
INNTLFLFDNAILEKDK
NT seq 774 nt   +upstreamnt  +downstreamnt
atgataaaaatatctacaacaattcttattatagtttgttatttgcatgcaagtactttt
tttggtgattcaaagcgcggttggttttattatgaacttgctgacaataataattcacag
gaaaaaaatgaaaccaaagtccaaaaaaggatgaatgcagatgatttatttatagcttca
atacctttaaacaacttagatcttttaacagccgaggaatttactgaaaccttcgaaaaa
gttagaaaaatagccatcatgaatcccacaaaaacaaatgtgatgacaatgcaaattatg
aataagtggcaagttgatcaatctgaaaaatttgctaaagtttgggttttaaacctttta
gaaaatccaaacttagagtatccagaaattcgcgatgacaaatttggcagaagcgaaatg
tttagacaaaaacaagaaaaaataaacaatttttataaagctcatcaagatgatttttct
tatgttgtttttgttagtaatttaaataaagaaagtaatgaaaaacaaaaaggcatatat
cgctcgctacaaagcgattatggtgtaaatgttgaatatgttaatgtagatgagcgtaaa
gacttgatttcaaaatttaaacttacaacgactcctgaaaatttctttgtttataaaaac
tcaaaaggagaggcaatttggcaaagagttaagtcaggactcacaaacaaagatgatatc
atcaacaatactttgtttttatttgataacgcgattttagagaaagataaataa

DBGET integrated database retrieval system