KEGG   Campylobacter jejuni subsp. doylei 269.97: JJD26997_1667Help
Entry
JJD26997_1667     CDS       T00573                                 

Gene name
panC
Definition
(GenBank) pantoate--beta-alanine ligase
  KO
K01918  pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
cjd  Campylobacter jejuni subsp. doylei 269.97
Pathway
cjd00410  beta-Alanine metabolism
cjd00770  Pantothenate and CoA biosynthesis
cjd01100  Metabolic pathways
cjd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjd00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    JJD26997_1667 (panC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    JJD26997_1667 (panC)
Enzymes [BR:cjd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     JJD26997_1667 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_ligase Lyase_1 CRS1_YhbY
Motif
Other DBs
NCBI-ProteinID: ABS43611
UniProt: A7H575
Position
1472156..1473004
Genome map
AA seq 282 aa AA seqDB search
MEVITSIKEAKQIVKNWKSHHLSIGYVPTMGFLHDGHLSLVKNAKTQDKVIVSIFVNPMQ
FGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDMTQMYLKNFSTYVDMNIITDKLCGAKR
PGHFRGVCTVLAKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDG
LAKSSRNVYLSEEERKASLAISQSIFLAEKLVREGKKNTSKIIQAMQDILEKEKLIKIDY
IELVDFNTMDNIENIADNVLGAVAVFVGETRLIDNFLVQGLK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcattacttctatcaaagaagcaaaacaaattgtaaaaaattggaaatcacat
catcttagcataggctatgttccaaccatgggttttttacacgatggacatttaagttta
gtcaaaaatgccaaaacacaagataaagttatagtaagtatctttgtaaatcctatgcaa
tttgggcctaatgaagatttttccagttatccaagagatttagaacgcgacatcaaaatg
tgtcaagataatggcgttgatatggtttttatccccgatatgactcaaatgtatcttaag
aattttagcacctatgtggatatgaacataatcaccgataaactttgtggagctaaaaga
cctggtcattttagaggcgtttgcacggttttggctaaattttttaacatcctaaaccct
gatatagtctatatggggcaaaaagacgcgcagcaatgtgtagtcgttaggcatatggtt
gatgatttaaattttgatttaaaaattcaaatttgccctatcattagagaagaagatggc
ttagctaaaagctctagaaatgtatatcttagcgaagaagaaagaaaagcgtcattagct
atatctcaaagtatttttttagctgaaaaattagtccgagaaggaaaaaaaaatacttct
aaaattatccaagctatgcaagatattttagaaaaagaaaaattaatcaaaatcgattat
atagaattagtagattttaacaccatggacaatattgaaaatatcgccgataatgtttta
ggagcggtagctgtttttgttggagaaacaagattgattgataattttttagtacaagga
ttaaaatga

DBGET integrated database retrieval system