KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0398Help
Entry
Cj0398            CDS       T00026                                 

Gene name
gatC
Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00970  Aminoacyl-tRNA biosynthesis
cje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cje00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cj0398 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:cje03029]
    Cj0398 (gatC)
Enzymes [BR:cje01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Cj0398 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Cj0398 (gatC)
Mitochondrial biogenesis [BR:cje03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Cj0398 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln Imm7 Rop
Motif
Other DBs
NCBI-GeneID: 904721
NCBI-ProteinID: YP_002343835
GeneDB: Cj0398
UniProt: Q9PIA5
Position
364326..364610
Genome map
AA seq 94 aa AA seqDB search
MQIDEKLLSKLEKLSALQITKNRNETIAQLSEIVNFVEKLNELDLDSQEITVSTIKGGAP
LRIDEIRNSNVIDEVLDCAPKKQEHFFVVPKIIE
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatagatgagaaattattaagcaagcttgaaaaattaagtgctttacaaataaca
aaaaacagaaatgaaaccattgcacagctaagtgaaattgtgaattttgttgaaaaatta
aacgaacttgatctagattcccaagagattactgtgagtactataaaaggtggagctcct
ttgaggattgatgagataagaaatagcaatgttattgatgaggttttggattgtgctcca
aaaaaacaagaacatttttttgttgttcctaaaatcatagaatga

DBGET integrated database retrieval system