KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0432cHelp
Entry
Cj0432c           CDS       T00026                                 

Gene name
murD
Definition
(RefSeq) UDP-N-acetylmuramoylalanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00471  D-Glutamine and D-glutamate metabolism
cje00550  Peptidoglycan biosynthesis
cje01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cje00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Cj0432c (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cj0432c (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cje01011]
    Cj0432c (murD)
Enzymes [BR:cje01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     Cj0432c (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cje01011]
 Precursor biosynthesis
  Amino acid ligase
   Cj0432c (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M DUF2387
Motif
Other DBs
NCBI-GeneID: 904757
NCBI-ProteinID: YP_002343869
GeneDB: Cj0432c
UniProt: Q9PI73
Position
complement(399936..401144)
Genome map
AA seq 402 aa AA seqDB search
MKISLFGYGKTTRAIAENLVDKFGPFDIYDDHFTETKKDTLGNLLLNPNDFDDNLSDIEI
PSPGFPPKHKLIQKAKNLQSEYDFFYDIMPKSVWISGTNGKTTTTQMATHLLSHIGAVMG
GNVGTPLAELNPYAKLWILETSSFTLHYTHKAKPEIYALLPISPDHLSWHGSFDNYVQDK
LSVLKRMNECDVVILPKIYANTPTKAHKISYEDEKDLAVKFGIDTEKISFKSPFLLDAIM
ALAIEKILLDTLSYKLLNSFVMEKNKLEELKDSQNRLWVNDTKATNESAVMAALSRYKDK
KIHLIIGGDDKGVDLSNLFDFMKGFDIELYAIGISTEKMLDYAKKANLKAYKCEVLSKAV
NEISNHLRVNEVALLSPACASLDQFNSYAERGKVFKECVNKI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcactttttggatacggaaaaaccacacgtgctattgctgaaaatttagta
gataaatttggaccttttgatatttatgatgatcattttacagaaacaaaaaaagataca
ctaggaaatttacttttaaatcctaatgattttgatgataatttaagcgatattgaaatt
cctagtccaggttttccaccaaagcacaaactcattcaaaaagcaaaaaatttacaaagc
gaatatgactttttttatgatatcatgccaaaatccgtttggataagcggaaccaatggc
aaaaccaccaccacacaaatggctacacatttattatcacacattggtgctgttatgggt
ggaaatgttggaactcctttagcagagcttaatccttatgcaaaactttggatacttgaa
acttcatcttttaccctacactacactcataaagctaaacctgaaatttatgcactttta
cctataagtcctgatcatctttcttggcatggaagttttgataattatgttcaagataag
ctaagcgttttaaaaagaatgaatgaatgtgatgtagtaatactgcctaaaatttatgca
aatactccaacaaaagctcataaaataagctatgaagatgaaaaagatctagctgttaaa
tttggcattgatacggaaaaaatttcctttaaaagtccttttttactcgatgctatcatg
gctttagctatagaaaaaattttacttgatactttaagctataagcttttaaatagcttt
gtaatggaaaaaaataaactcgaagagcttaaagacagtcaaaataggctttgggtaaat
gacactaaagctacaaatgaaagtgctgtaatggctgcacttagtcgctataaagataaa
aaaatccatcttatcatagggggagatgataagggtgtagatcttagcaatttatttgat
tttatgaaaggatttgatatagaactctatgctataggtattagtaccgaaaaaatgctt
gattatgcaaaaaaagcgaatttgaaagcctataaatgcgaagttttatctaaagctgta
aatgaaatttcaaatcacttaagagtcaatgaagtagctcttttaagtcccgcttgtgca
agtttagatcagttcaactcttacgcagagcgtggaaaagtctttaaagaatgtgtgaat
aaaatttaa

DBGET integrated database retrieval system