KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0498Help
Entry
Cj0498            CDS       T00026                                 

Gene name
trpC
Definition
(RefSeq) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
cje01130  Biosynthesis of antibiotics
cje01230  Biosynthesis of amino acids
Module
cje_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cje00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cj0498 (trpC)
Enzymes [BR:cje01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cj0498 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AEP1
Motif
Other DBs
NCBI-GeneID: 904828
NCBI-ProteinID: YP_002343932
GeneDB: Cj0498
UniProt: Q9PI11
Structure
PDB: 

Position
462831..463607
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaggctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtatcgctttaaattat
gagaagaacaaagctgcggcgatttctgttttaactgagccgcatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacgcaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcggattttgtattatta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaatccatgataaagaggatttgagtaaggctatttttgct
ggagcggatattatcggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

DBGET integrated database retrieval system