KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1401cHelp
Entry
Cj1401c           CDS       T00026                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00010  Glycolysis / Gluconeogenesis
cje00051  Fructose and mannose metabolism
cje00562  Inositol phosphate metabolism
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
cje01120  Microbial metabolism in diverse environments
cje01130  Biosynthesis of antibiotics
cje01200  Carbon metabolism
cje01230  Biosynthesis of amino acids
Module
cje_M00002  Glycolysis, core module involving three-carbon compounds
cje_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cj1401c (tpiA)
   00051 Fructose and mannose metabolism
    Cj1401c (tpiA)
   00562 Inositol phosphate metabolism
    Cj1401c (tpiA)
Enzymes [BR:cje01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cj1401c (tpiA)
Exosome [BR:cje04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cj1401c (tpiA)
  Exosomal proteins of bladder cancer cells
   Cj1401c (tpiA)
  Exosomal proteins of melanoma cells
   Cj1401c (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM BtpA
Motif
Other DBs
NCBI-GeneID: 905690
NCBI-ProteinID: YP_002344784
GeneDB: Cj1401c
UniProt: Q9PMQ6
Position
complement(1335474..1336145)
Genome map
AA seq 223 aa AA seqDB search
MIFAANLKCNHTRASFKIYAKILNKTMGVKCDDIIVFPPSIAFLENENNFIQGAQNFYPC
VNGAFTGELGKEHLDEFGIKCVLIGHSERRALGDEEFIKAKFDFAKEHGYKIVFCIGENL
DTKNSGKTLEFLKKQLEIIDLNYEKLIIAYEPIYSIGTGVSAQSTDIAKVLEFLASLTKV
PLLYGGSVNENNIKEILSVNHCGGVLIGSAALKVENFIKLIKG
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgatctttgctgcaaatttaaaatgcaatcacacaagagcaagctttaaaatttatgct
aaaattttaaataaaactatgggggtaaaatgcgatgatattatcgtttttccacctagt
atagcatttttagaaaatgaaaataacttcatacaaggagcgcaaaatttttatccttgt
gttaatggtgcttttacaggcgagcttggaaaagaacatttggacgaatttgggattaaa
tgtgtcttaatcgggcattctgaaagaagagctttaggagatgaagaatttattaaggct
aaatttgattttgctaaagagcatggttataaaattgttttttgtataggtgaaaattta
gatacaaaaaattcaggcaagactttagagtttttaaaaaaacaacttgaaattattgat
ttaaattatgaaaaactcatcatcgcttatgagcctatttattctataggaacgggagtg
agcgcacaaagtacagatatcgctaaagtgcttgaatttttagcgagtttaaccaaagta
cctttgctttatggtggaagtgtgaatgaaaataatatcaaagaaattttaagtgtaaat
cattgtggtggagttttgataggctctgcagctttaaaagtagaaaattttataaaatta
atcaaaggataa

DBGET integrated database retrieval system