KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1583c
Entry
Cj1583c           CDS       T00026                                 
Name
(RefSeq) peptide ABC transporter permease
  KO
K25104  nickel transport system permease protein
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Brite
KEGG Orthology (KO) [BR:cje00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cje02000]
    Cj1583c
Transporters [BR:cje02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Nickel transporter
    Cj1583c
SSDB
Motif
Pfam: BPD_transp_1 BPD_transp_1_N
Other DBs
NCBI-GeneID: 905853
NCBI-ProteinID: YP_002344952
UniProt: Q0P845
Position
complement(1512055..1512999)
AA seq 314 aa
MLKRLVFSIFIAFFSTFLCFVLLHFSKGSIAYANGVNSQSKEFVQRIEQNLGLDKPLLEQ
YKIWLFKALKGDLGVSFLSGESVLKLIKERIFNTFILGFSALMLLFLLSVFLALLGYYYK
ESFIDKIITFLAFNFFALPPFVLALLFVLIFGIFWKILPVMGSSDIGFEDDFLNRLEHLI
LPVLVLVLSHLALFLRIARNFINESFSQIFIQNLYARALREKDIYFLVLKYSLSPIVAYF
GGSALSFMMGTYVVESVFAYKGLGSLLFKSIIFKDYPIVLALIFFSVLLAAFFTFLSDIV
ARILNPRLRRLDFV
NT seq 945 nt   +upstreamnt  +downstreamnt
gtgctaaaacgcttagtttttagtattttcatagcattttttagcacttttttatgtttt
gttttacttcattttagtaaaggcagtatagcttatgctaatggagttaattcacaaagt
aaagaatttgttcaaagaatagaacaaaatttagggcttgataagcctttgctagagcag
tataaaatttggctttttaaggctttaaaaggggacttaggggtttcttttttaagtgga
gaaagtgttttaaagcttataaaagaaagaatttttaatacttttattttgggttttagt
gccttaatgcttttatttttgctcagtgtttttttggcacttttgggatattattataaa
gaaagttttatagataaaatcatcacttttttagcttttaatttttttgctttacctcct
tttgttttggctttattgtttgttttgatttttggaattttttggaaaattttgcctgtt
atgggaagtagtgatataggctttgaagatgattttttaaatcgtttagagcatttgatt
ttgcctgttttggtgctcgttttatcacatttggcgttatttttaaggattgctagaaat
tttatcaatgaaagtttttctcaaatttttattcaaaatttatacgctagggctttaagg
gagaaagatatttattttttagttttgaaatattctttaagtcctattgtggcttatttt
gggggaagtgctttaagttttatgatgggaacttatgtggtagaaagtgtctttgcttac
aaggggcttggatctttactttttaaaagtattatttttaaagattatcctattgtgctt
gcgcttatattttttagtgttttgcttgcagcattttttacatttttaagtgatattgta
gctaggattttaaatcctagattaagaaggcttgattttgtttaa

DBGET integrated database retrieval system