KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj1598Help
Entry
Cj1598            CDS       T00026                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Pathway
cje00340  Histidine metabolism
cje01100  Metabolic pathways
cje01110  Biosynthesis of secondary metabolites
cje01230  Biosynthesis of amino acids
Module
cje_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:cje00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Cj1598 (hisD)
Enzymes [BR:cje01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Cj1598 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 905868
NCBI-ProteinID: YP_002344967
GeneDB: Cj1598
UniProt: Q9PM77
Position
1526347..1527633
Genome map
AA seq 428 aa AA seqDB search
MQILVYDNLDEKQKEEALKRPAISAKDEISKIVSSIIKEVQEKGDKALIEQALKFDKAEI
SKIKITQEEITQASNRLDKDLQEAILVAYENIKKFHEAQIPHEIALETTKGVKCEVLTRP
IEKVGLYIPGGLAPLFSTVLMLAIPAKIAGCEKIVLASPAKINDAVLFCAKLCGVDEIYQ
MGGAGAIAALTYGTQSVLKVDKIFGPGNAFVTEAKRQVSSDINGAAIDMQAGPSEVLVIA
DDLANEKFVASDLLSQAEHGADSQVILVCLSQDFAKKASDEVQSQLELLPRKELASKSIA
NSRIIIAKDLNQALEISNLYAPEHLIIQTQNPRELLKGVKHAGSVFLGAYSPESMGDYAS
GTNHVLPTYGLTKTHSSLGLADFSKRMTVQELSKEGFLALGKSVEILAQNEHLDAHKNAV
TFRLESLK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattttagtatatgataatttggatgaaaaacaaaaagaagaagcgttaaaacgc
cctgctataagtgcgaaagatgaaatttcaaaaatagtaagttctatcattaaagaagtg
caagaaaaaggcgataaagctttgatagaacaagctttgaaatttgataaggctgaaatt
tcaaagattaaaatcactcaagaagaaatcactcaagcaagcaatcgtttagataaagat
ttacaagaagctattttagtggcttatgaaaatatcaaaaaatttcacgaagcccaaatc
ccacatgaaatcgctcttgaaactacaaaaggcgttaaatgtgaagttttaacacgccct
atagaaaaagtaggactttacataccagggggtttggcacctttgttttcaacggtttta
atgctagctattcctgcaaaaattgcaggttgtgaaaaaatcgttttagcaagtcctgca
aaaatcaatgatgctgtgcttttttgtgctaagctttgtggcgtggatgaaatttatcaa
atgggcggtgcaggagctatagcagctttgacttacggtacccaaagtgttttaaaggtg
gataaaatttttggcccaggaaatgcctttgtaaccgaagcaaaacgccaagtaagtagt
gatataaacggagcagctattgatatgcaagcaggacctagtgaagttttagtcatagct
gatgatttagctaatgaaaaatttgtagctagtgatttgctttcacaagctgaacatggt
gcagattctcaagtgattttagtgtgtttaagtcaagattttgctaaaaaagcaagtgat
gaagtccaaagtcaattagaacttttgcctcgcaaagaacttgcaagcaaaagcattgct
aattcacgcattatcatagctaaagatttaaatcaagccttagaaatttcaaatctttac
gcccctgaacatttgatcatacaaactcaaaatccacgagaacttttaaaaggtgtaaaa
cacgcaggatcagtatttttaggagcttattccccagagtctatgggtgattatgcaagt
gggacaaatcatgttttacctacttatggacttactaaaacgcattctagtttaggtttg
gcagattttagtaaaagaatgaccgttcaagagttaagtaaagaaggttttttagcttta
ggtaaaagtgttgaaattttagcacaaaatgagcatttagacgcgcacaaaaatgcagta
acttttcgtttagaaagcttaaaatga

DBGET integrated database retrieval system