KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_00890Help
Entry
N135_00890        CDS       T02844                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Pathway
cjei00564  Glycerophospholipid metabolism
cjei01100  Metabolic pathways
cjei01110  Biosynthesis of secondary metabolites
Module
cjei_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:cjei00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    N135_00890
Enzymes [BR:cjei01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     N135_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase ERO1
Motif
Other DBs
NCBI-ProteinID: AGV56640
Position
835188..835988
Genome map
AA seq 266 aa AA seqDB search
MSFSKESSRLFGFVAGIKFPKMIQKVINENYVKYFNINMSEFKAPCEYESLNALFTRTLQ
IPRKFEEGFISPSDGKILECGSTFLANEEHFAFSIKGHAYSVEELLKDSFEKDELKNGLD
YVNIYLSPKDYHRYHSPCDMQILSATYTSGVLYSVNEKHLECISNLYVKNERVSLKCQNE
KGIFWLVFVGAQNVGKMRFNFDASIQTNAKISHNFTRKYENLNFKKGEELGNFELGSTIV
LISQKGLLTFNLKVGQGIKFGEKIAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttcaaaagaaagttcgagactttttggttttgtagcggggattaaatttcct
aaaatgatacaaaaagttattaatgaaaattatgttaagtattttaatatcaatatgagt
gaatttaaagctccttgtgaatatgagagtttaaatgctctttttacaagaactttacaa
attccaagaaaatttgaagaaggttttatcagtccaagtgatggtaaaattttagagtgt
ggaagtacttttttagcaaatgaagaacattttgctttttctataaaaggacatgcttat
agcgttgaggagcttttaaaagatagctttgaaaaagatgaacttaaaaatgggcttgat
tatgtcaatatttatctttctccaaaagattatcatcgttatcacagcccttgtgatatg
caaattttaagtgcaacttacacaagtggagtgctttatagcgtaaatgaaaaacattta
gaatgcattagtaatttatatgtaaaaaatgaaagagtgagcttgaaatgtcaaaatgaa
aaaggtattttttggcttgtttttgtaggagcgcaaaatgtaggaaaaatgcgttttaat
tttgatgcaagcatacaaaccaatgctaaaatttctcataattttactagaaaatatgaa
aatttaaatttcaaaaaaggcgaagaactaggaaattttgagctaggttctactatagtt
ttaatctctcaaaaaggacttttaacttttaatttaaaagtagggcagggtattaaattt
ggagaaaaaatagcggattag

DBGET integrated database retrieval system