KEGG   Campylobacter jejuni subsp. jejuni 00-2425: N135_01228Help
Entry
N135_01228        CDS       T02844                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cjei  Campylobacter jejuni subsp. jejuni 00-2425
Brite
KEGG Orthology (KO) [BR:cjei00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    N135_01228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: AGV56959
Position
1165258..1166784
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFVIFIISTIAFVIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPNSLDPMLFVIIMLAALL
SSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGLLKFDGIQTLSMVKWSEILRIAISWV
ASPLLGGIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKFKEEYFLNLKTKSQEEQIK
ELSAIALDEEEQENNFYRNKMKEFKDQEKDIDIYSILKTHMPIIACIAAAIISAMFLFKG
LNNVSTLDILQNFWIIGIIGTISYVVTFAIVKIVKKTELNKTTDRIFSWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAMFGVALVVGLWFLGKEVITTVG
SKLATIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAILGIGVYNKNANWIMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacaacctcatagcttttgttatttttattatcagtactatcgcatttgtt
atttggggatttggttatatttcgcaacatcaactgattctttttattcttgcttctata
tttggtatttttatggcatttaatataggtggaaatgatgtagccaattcttttggaaca
agcgttggcgcaaaaacagtaaccattaaacaagctttaattatagcagctgtttttgag
ctaagcggggcaatcttcgcaggcgcagaagttactaaaaccatacgcagcggtattgtt
atttttccaaattctttagatcctatgctttttgttatcattatgcttgctgcactttta
agctctggggtttggatttttattgcaaccaagaaaggcttacctgtatcaaccacacac
agtatagttggtgggattgtaggtgctagcattatgatggggcttttaaaatttgatggg
atccaaacactctctatggttaaatggagtgaaattttaagaatagctatttcttgggta
gcttcgcctcttttagggggtattgtagcttatattatttattcatatattgataaaaaa
attttaaaaccatcagaaaaactaaatgatgatttgaaaaatatcaaaaaagaaagaaaa
aaattcaaagaagaatattttttaaatttaaaaacaaaatcccaagaagaacaaatcaaa
gaactttccgctatagctttggatgaagaagaacaagaaaataatttctatagaaataaa
atgaaggaatttaaggatcaagaaaaagatatagatatttactctattttaaaaactcat
atgccaatcattgcttgtattgctgctgctatcatttcggcaatgtttttatttaaaggt
ttaaataatgttagcactttggatattttacaaaacttttggattatcggaattatagga
actataagttatgttgtaacatttgctatagtcaaaatcgttaaaaaaacagaacttaat
aaaactactgatagaattttctcatggtttcaaatatttacagcctctagttttgcattt
tcacacggagccaatgatatagccaatgctataggtccttttgcagcgattttagatgtc
ttaaaaaacggtacaattaacgcgacttctcctgtaccttttgcagctttagctatgttt
ggagttgctctagttgtagggctttggtttttaggtaaagaagtgattactacagtgggt
tcaaaacttgcaaccatacgccctactactggattttctgcagaacttggtgcaagcata
gttatactcttagctacacaatttggaattcctgttagctccacccatatactcataggt
gctatattgggtataggagtgtataataaaaacgcaaattggattatgatgaagcctata
ggattggcttggattatcactttaccagccgctggtattatggcagcacttgtattttta
ggatttaaactatctttaggaatttaa

DBGET integrated database retrieval system