KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_00476Help
Entry
N564_00476        CDS       T02841                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00620  Pyruvate metabolism
cjej00630  Glyoxylate and dicarboxylate metabolism
cjej01100  Metabolic pathways
cjej01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    N564_00476
   00630 Glyoxylate and dicarboxylate metabolism
    N564_00476
Enzymes [BR:cjej01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     N564_00476
    1.2.1.22  lactaldehyde dehydrogenase
     N564_00476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC FIST_C
Motif
Other DBs
NCBI-ProteinID: AGV50803
Position
455813..457252
Genome map
AA seq 479 aa AA seqDB search
MTTYLNYIDGKFIPHNGEFIEVLNPATKEVISRVASASLEDTKRAIEAAKKAQKVWEAKP
AIERANHLKEIASLIRKNANFLTEVLMQEQGKTRVLASIEINFTADYMDYTAEWARRYEG
EIIQSDRANEHIYLYKSAIGVIGGILPWNFPFFLIARKMAPALLTGNTIVIKPSSETPNN
AFEFAKLVSQSSLPKGVFNLVAGKGSVVGYELSSNENIGMVSLTGSVEAGTRVMEAAAKN
IIKVSLELGGKAPAIVCKDADIDLAVEAIKASRICNNGQVCNCAERAYVHTSVYDEFVDK
FVKAMSKVSVGNTLKGDFDMGPLVNQAGVDNALAMLQRATAKGAIVECGGKIIDTSGYYF
PASVLTNVKHEDEIMQKEIFAPILPIAKFDTLDEAIDMANDCEYGLTSSIYTQNLDIAMR
ASREIKFGETYINRENFEAMQGFHAGFRKSGIGGADGKHGLEEYLATHVVYLQYNTNKQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatttaaattatattgatggaaagtttatcccacataatggagaatttatc
gaagttttaaatccagctaccaaagaagtgatttcaagagtagctagcgcttctttagaa
gatactaaaagagcgattgaagcagccaaaaaagcacaaaaagtttgggaggctaaacca
gcgattgaaagagcaaatcatttaaaagaaatagctagtttaatacgcaaaaatgctaat
ttcttaaccgaagttttaatgcaagagcaaggaaaaaccagagttttggctagcatagag
attaattttacagcagattatatggattatacggccgaatgggctagaagatatgagggt
gaaatcatacaaagcgatagggctaatgagcatatatatttatataaaagtgctattggg
gtaattggtggaattttaccttggaattttccatttttcttaatcgcaaggaagatggca
cctgctttactaacaggaaatactattgttataaagccaagcagtgaaactccaaacaat
gcttttgaatttgcaaagcttgtttcgcaaagttctttaccaaaaggtgtttttaactta
gttgcaggtaaaggcagtgtagtaggatatgaattatcaagcaatgaaaatataggtatg
gtaagtcttacaggaagtgttgaagcagggactagagtaatggaagctgcagctaaaaat
attatcaaagtttctttagaacttggtggaaaggcgccagctatagtgtgcaaagatgcg
gatattgatttagcagtagaagcgattaaagcaagtagaatttgcaataacggacaagtt
tgtaattgtgctgaaagagcttatgtgcatacaagcgtttatgatgaatttgtagacaaa
tttgtaaaagccatgagtaaagtaagtgttggaaataccttaaaaggtgattttgatatg
ggaccattggtcaatcaagcaggagttgataatgctttggcaatgcttcaaagagctaca
gctaaaggagcgattgtagaatgcggtggaaaaatcattgatacaagtgggtattatttt
cccgcaagcgttcttactaatgttaaacacgaagatgagatcatgcaaaaagaaattttt
gctccgattttacctattgctaaatttgatacacttgatgaagctattgatatggcaaat
gattgtgaatatggtcttacaagttctatttatacacaaaatttagatatagcaatgaga
gctagcagagaaattaaatttggtgaaacttatattaatcgtgaaaattttgaggctatg
caaggttttcatgcaggctttagaaaaagtggcataggcggagctgatggaaaacatggt
cttgaagaatatttagctacccatgtggtatatttgcagtataatactaataaacaatga

DBGET integrated database retrieval system