KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_00485Help
Entry
N564_00485        CDS       T02841                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjej01100  Metabolic pathways
cjej01110  Biosynthesis of secondary metabolites
cjej01130  Biosynthesis of antibiotics
cjej01230  Biosynthesis of amino acids
Module
cjej_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    N564_00485
Enzymes [BR:cjej01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     N564_00485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AEP1
Motif
Other DBs
NCBI-ProteinID: AGV50811
Structure
PDB: 

Position
463184..463960
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaggctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtatcgctttaaattat
gagaagaacaaagctgcggcgatttctgttttaactgagccgcatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacgcaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcggattttgtattatta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaatccatgataaagaggatttgagtaaggctatttttgct
ggagcggatattatcggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

DBGET integrated database retrieval system