KEGG   Campylobacter jejuni subsp. jejuni 00-2426: N564_01695Help
Entry
N564_01695        CDS       T02841                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
cjej  Campylobacter jejuni subsp. jejuni 00-2426
Pathway
cjej03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cjej00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    N564_01695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cjej03011]
    N564_01695
Ribosome [BR:cjej03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    N564_01695
  Bacteria
    N564_01695
  Archaea
    N564_01695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGV51994
Position
complement(1656668..1657093)
Genome map
AA seq 141 aa AA seqDB search
MSKALIKFIRLSPTKARLIAREVQGMNAELAMASLKFMPNKGAKYIANAISSAVANGGFE
ANEVIVKSCRVDAAAVLKRFRPRARGSASRIRKPTSHILVEVAKAEVKSEEKKTVAKKTT
TTKAPAKKTTSTKKATVKKES
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagcattaattaaattcataagattatctccaactaaagcaagattgattgct
agagaagttcaggggatgaatgcagaattagctatggctagtttaaaatttatgccaaat
aaaggtgcaaaatacattgcaaacgcaatttcaagcgcagtagcaaatggtggctttgaa
gcaaacgaagtgattgtaaaaagttgtcgtgttgacgcagctgcggtattaaaaagattt
agaccaagagctagaggaagtgcaagtcgtattagaaaaccaacttcacatattttagta
gaagtggcaaaagcggaagtgaaatctgaagagaaaaaaacagtagctaaaaaaactact
acaacaaaagctccagctaaaaaaacaacaagcactaaaaaagcaacagtgaaaaaggaa
agctaa

DBGET integrated database retrieval system