KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00822Help
Entry
N755_00822        CDS       T02843                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Pathway
cjen00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    N755_00822
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cjen01007]
    N755_00822
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cjen03016]
    N755_00822
Enzymes [BR:cjen01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     N755_00822
Amino acid related enzymes [BR:cjen01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   N755_00822
Transfer RNA biogenesis [BR:cjen03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    N755_00822
 Prokaryotic Type
    N755_00822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1 tRNA-synt_1f Helicase_Sgs1 DUF4919
Motif
Other DBs
NCBI-ProteinID: AGV47668
Position
794010..795398
Genome map
AA seq 462 aa AA seqDB search
MRLLDSVTKEKIKLDKKDISIYLCGPTVYDDAHLGHARSSVCFDLLRRVLLAQGNRVKFA
RNYTDIDDKILKKMAQSGQTLEEITEFYIKSYEEDMRVLNVLDPDFKPRATHYITAMLDL
IKKLAKDGFVYTLEDGIYFDTSKDEKYLSLSNRNLEENISRLSNEVQKRNESDFVLWKFD
ENFYESEFGKGRPGWHTECVAMIDSIFENTLDIHAGGIDLLFPHHENEAAQCRCGCKRKL
ANIWLHNGFVKIDGEKMSKSLNNSFFIKDALKEFMGEALRFYLLSSHYRSHFNYSLSDLE
NAKKRLDKFYRLKKRLDLGEISDFDVLNDIGIKSEIAKQILEILNDDLNVSKALALLDDF
ISSANLELDKESKNKILKQNIKEALSELAKIFGFGFMDATLYFQWGVSKEEREEIEKLIL
ERTEAKKNKDFNTADAIREQLNSKKITLLDTPNGTIWEKINA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgagattattagatagtgtaacaaaagagaaaataaaacttgataaaaaagatattagt
atttatttatgcggacctacggtttatgatgatgcacatttaggacatgcaagaagtagt
gtttgttttgatcttttgcgtagggttttacttgctcaaggcaatagggtaaaatttgct
agaaattatacagatattgatgataagattttgaaaaaaatggctcaaagtggtcaaact
ttagaggaaattacggaattttatatcaaaagttatgaagaggatatgagggttttaaat
gtattagatcctgattttaaacctcgtgcaacgcattatataacagctatgcttgatttg
attaaaaagcttgctaaggatgggtttgtttatactctagaagatggaatttattttgat
acaagtaaagatgaaaaatatttaagcctatcaaatcgcaatttagaagaaaatatctct
cgtctaagtaatgaagtgcaaaaaagaaatgaaagcgattttgtgctttggaaatttgat
gaaaatttttacgaaagtgaatttggcaaagggcgtccaggttggcatactgaatgtgtt
gctatgattgattctatttttgaaaatacccttgatatacatgctggagggatagatttg
ctttttcctcatcatgaaaatgaagctgcgcaatgtcgttgtggatgtaagagaaaatta
gcaaatatttggcttcacaatggttttgtaaaaatcgatggcgaaaaaatgagtaaaagt
ttaaataatagtttttttataaaagatgctttaaaagaatttatgggcgaggctttaaga
ttttatcttttgagttctcattatagatctcattttaattattctttatcggatttagaa
aatgctaaaaaacgtttagataaattttatcgccttaaaaaaagattggatttaggtgaa
atttctgattttgatgttttaaatgatattggaataaaaagcgaaattgctaagcaaatt
ttagagattttaaatgatgatttaaatgtttctaaagccttagctcttttggatgatttt
atcagtagtgcaaatttagagttggataaagaaagcaaaaataaaattttaaaacaaaat
atcaaagaagctttaagtgagctagctaaaatttttggctttggttttatggatgcaact
ttatattttcaatggggtgtaagcaaagaagaacgagaagagattgaaaagttaatttta
gaaagaactgaggctaagaaaaacaaagattttaacacagctgatgcaataagagagcaa
ttaaatagtaaaaaaatcactcttttagatactccaaatggaacaatttgggagaaaata
aatgcataa

DBGET integrated database retrieval system