KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_01195Help
Entry
N755_01195        CDS       T02843                                 

Definition
(GenBank) phosphate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Brite
KEGG Orthology (KO) [BR:cjen00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    N755_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: AGV48034
Position
1165628..1167154
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFVIFIISTIAFVIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPNSLDPMLFVIIMLAALL
SSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGLLKFDGIQTLSMVKWSEILRIAISWV
ASPLLGGIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKFKEEYFLNLKTKSQEEQIK
ELSAIALDEEEQENNFYRNKMKEFKDQEKDIDIYSILKTHMPIIACIAAAIISAMFLFKG
LNNVSTLDILQNFWIIGIIGTISYVVTFAIVKIVKKTELNKTTDRIFSWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAMFGVALVVGLWFLGKEVITTVG
SKLATIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAILGIGVYNKNANWIMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacaacctcatagcttttgttatttttattatcagtactatcgcatttgtt
atttggggatttggttatatttcgcaacatcaactgattctttttattcttgcttctata
tttggtatttttatggcatttaatataggtggaaatgatgtagccaattcttttggaaca
agcgttggcgcaaaaacagtaaccattaaacaagctttaattatagcagctgtttttgag
ctaagcggggcaatcttcgcaggcgcagaagttactaaaaccatacgcagcggtattgtt
atttttccaaattctttagatcctatgctttttgttatcattatgcttgctgcactttta
agctctggggtttggatttttattgcaaccaagaaaggcttacctgtatcaaccacacac
agtatagttggtgggattgtaggtgctagcattatgatggggcttttaaaatttgatggg
atccaaacactctctatggttaaatggagtgaaattttaagaatagctatttcttgggta
gcttcgcctcttttagggggtattgtagcttatattatttattcatatattgataaaaaa
attttaaaaccatcagaaaaactaaatgatgatttgaaaaatatcaaaaaagaaagaaaa
aaattcaaagaagaatattttttaaatttaaaaacaaaatcccaagaagaacaaatcaaa
gaactttccgctatagctttggatgaagaagaacaagaaaataatttctatagaaataaa
atgaaggaatttaaggatcaagaaaaagatatagatatttactctattttaaaaactcat
atgccaatcattgcttgtattgctgctgctatcatttcggcaatgtttttatttaaaggt
ttaaataatgttagcactttggatattttacaaaacttttggattatcggaattatagga
actataagttatgttgtaacatttgctatagtcaaaatcgttaaaaaaacagaacttaat
aaaactactgatagaattttctcatggtttcaaatatttacagcctctagttttgcattt
tcacacggagccaatgatatagccaatgctataggtccttttgcagcgattttagatgtc
ttaaaaaacggtacaattaacgcgacttctcctgtaccttttgcagctttagctatgttt
ggagttgctctagttgtagggctttggtttttaggtaaagaagtgattactacagtgggt
tcaaaacttgcaaccatacgccctactactggattttctgcagaacttggtgcaagcata
gttatactcttagctacacaatttggaattcctgttagctccacccatatactcataggt
gctatattgggtataggagtgtataataaaaacgcaaattggattatgatgaagcctata
ggattggcttggattatcactttaccagccgctggtattatggcagcacttgtattttta
ggatttaaactatctttaggaatttaa

DBGET integrated database retrieval system