KEGG   Campylobacter jejuni subsp. jejuni R14: H730_02735Help
Entry
H730_02735        CDS       T03187                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
cjer  Campylobacter jejuni subsp. jejuni R14
Pathway
cjer00471  D-Glutamine and D-glutamate metabolism
cjer00550  Peptidoglycan biosynthesis
cjer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjer00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    H730_02735 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H730_02735 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cjer01011]
    H730_02735 (murD)
Enzymes [BR:cjer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     H730_02735 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:cjer01011]
 Precursor biosynthesis
  Amino acid ligase
   H730_02735 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M DUF2387
Motif
Other DBs
NCBI-ProteinID: AHW91475
Position
complement(468511..469719)
Genome map
AA seq 402 aa AA seqDB search
MKISLFGYGKTTRAIAENLVDKFGPFDIYDDHFTETKKDTLGNLLLNPNDFDDNLSDIEI
PSPGFPPKHKLIQEAKNLQSEYDFFYDVMPKSVWISGTNGKTTTTQMATHLLSHIGAVMG
GNVGTPLAELNPYEKLWILETSSFTLHYTHKAKPEIYALLPISPDHLSWHGSFDNYVQDK
LSVLKRMNECDVTILPKIYANTPTKAHKISYEDEKDLAVKFGIDTEKISFKSPFLLDAIM
ALAIEKILLDTLSYELLNSFVMEKNKLEEIKDSQNRLWVNDTKATNESAVMAALSRYKDK
KIHLIIGGDDKGVDLSNLFDFMKGFDIELYAIGISTEKMLDYAKKANLKAYKCEVLSKAV
NEISNHLRVNEVALLSPACASLDQFNSYAERGKVFKECVNKI
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttcactttttggatacggaaaaaccacacgtgctattgctgaaaatttagta
gataaatttggaccttttgatatttatgatgatcattttacagaaacaaaaaaagataca
ctaggaaatttacttttaaatcctaatgattttgatgataatttaagcgacattgaaatt
cctagtccaggttttccaccaaagcacaaactcattcaagaagcaaaaaatttacaaagt
gaatatgactttttttacgatgtcatgccaaaatctgtttggataagtggaactaatgga
aaaacaaccactactcaaatggctacacatttattatcacatattggtgctgttatgggt
ggaaatgttggaactcctttagcagagcttaatccttatgaaaaactttggatacttgaa
acttcatcttttaccctacactacactcataaagctaaacctgaaatttatgcactttta
cccatcagtcctgatcatctttcttggcatggaagttttgataattatgttcaagataag
ctaagcgttttaaaaagaatgaatgaatgtgatgtaacaatactgcctaaaatttatgca
aatactccaacaaaagctcataaaataagctatgaagatgaaaaagatctagctgttaaa
tttggcattgatacggaaaaaatttcctttaaaagtccttttttactcgatgctatcatg
gctttagctatagaaaaaattctacttgatactttaagctatgagcttttaaatagcttt
gtaatggaaaaaaataaactcgaagagattaaagacagtcaaaataggctttgggtaaat
gacactaaagccacaaatgaaagtgcagtaatggctgcgcttagtcgctataaagataaa
aaaatccatcttatcatagggggagatgataagggtgtagatcttagcaatttatttgat
tttatgaaaggatttgatatagaactctatgctataggcattagtaccgaaaaaatgctt
gattatgcaaaaaaagcgaatttgaaagcctataaatgtgaagttttatctaaagctgta
aatgaaatttcaaatcacttaagagtcaatgaagtagctcttttaagtcccgcttgtgca
agtttagatcagttcaactcttacgcagagcgtggaaaagtctttaaagaatgtgtgaat
aaaatttaa

DBGET integrated database retrieval system