KEGG   Campylobacter jejuni subsp. jejuni R14: H730_05850Help
Entry
H730_05850        CDS       T03187                                 

Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cjer  Campylobacter jejuni subsp. jejuni R14
Pathway
cjer00220  Arginine biosynthesis
cjer01100  Metabolic pathways
cjer01110  Biosynthesis of secondary metabolites
cjer01130  Biosynthesis of antibiotics
cjer01230  Biosynthesis of amino acids
Module
cjer_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cjer00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    H730_05850
Enzymes [BR:cjer01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     H730_05850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N DUF3600
Motif
Other DBs
NCBI-ProteinID: AHW92023
Structure
PDB: 

Position
complement(1032265..1033185)
Genome map
AA seq 306 aa AA seqDB search
MKHFLTLRDFSKEEILSLVNHASELKKEPKKLLQDKTLAMIFEKNSTRTRMAFELAITEL
GGKALFLSSNDLQLSRGEPVKDTARVIGAMVDFVMMRVNKHETLLEFARYSKAPVINALS
ELYHPTQVLGDLLTIKEWNKMQNGIAKVAFIGDSNNMCNSWLIAAAILGFEFSIAIPKNY
KISPEIWEFAMKQALISGAKISLGHDKFEALKDKDVVITDTWVSMGEENEKERKIKEFEG
FMIDEKAMSVANKDAILLHCLPAYRGYEVSEEIFEKHADVIFEEARNRLYVVKALLCFLD
NQRGRE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattttttaactttaagagatttttctaaggaggaaattttaagccttgtaaat
catgctagcgagcttaaaaaagagcctaaaaaacttttacaagataaaactttagcaatg
atttttgagaaaaactctacaagaacaagaatggcatttgaattagccataacagagctt
ggcggaaaggctttgtttttaagcagcaatgatttacaacttagtcgtggtgagcctgta
aaggatacagctagggtgataggggcgatggttgattttgtgatgatgagggtcaataaa
catgaaactttactcgaatttgcaagatattctaaagctcctgtgatcaatgctttaagc
gagctttatcaccctactcaggttttaggagatttgcttactatcaaagaatggaataag
atgcaaaatggtatagcaaaagttgcttttatcggagatagtaacaatatgtgcaattct
tggcttattgcggctgcgattttgggctttgaatttagtatagctataccaaaaaactat
aaaattagccctgaaatttgggaatttgctatgaaacaggctttgatttcaggagctaaa
atttccttaggccatgataaatttgaagccttaaaggataaagatgtagtcattaccgat
acttgggtttccatgggcgaagagaatgaaaaagaacgcaagattaaagaatttgaagga
tttatgatcgatgaaaaggctatgagcgttgccaataaagacgcgatattgcttcattgt
ttgcctgcttatagaggttatgaagtgagtgaagaaatttttgaaaaacatgcagatgtg
atttttgaagaagcaagaaaccgcctttatgtggtaaaagccttgctttgctttttggat
aatcagagaggaagagaatga

DBGET integrated database retrieval system