KEGG   Campylobacter jejuni subsp. jejuni R14: H730_08785Help
Entry
H730_08785        CDS       T03187                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
cjer  Campylobacter jejuni subsp. jejuni R14
Pathway
cjer00230  Purine metabolism
cjer00250  Alanine, aspartate and glutamate metabolism
cjer01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjer00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    H730_08785
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H730_08785
Enzymes [BR:cjer01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     H730_08785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AHW92568
Structure
PDB: 

Position
complement(1582196..1583446)
Genome map
AA seq 416 aa AA seqDB search
MSKADIIVGIQWGDEGKGKVVDKLCENYDFVCRSAGGHNAGHTIWVNGVRYALHLMPSGV
LHPRCINIIGNGVVVSPEVLIAEMAQFENLKGRLYISDRAHLNLKHHSLIDIAKEKLKGK
NAIGTTGKGIGPSYADKINRTGHRVGELLEPQRLCEALIKDFEANKTFFEMLEIEIPSAE
ELLADLKRFNEILTPYITDTTRMLWKALDEDKRVLLEGAQGSMLDIDHGTYPYVTSSSTI
SAGALTGLGLNPKEAGNIIGIVKAYATRVGNGAFPTEDKGEDGEKIAQIGKEIGVSTGRK
RRCGWFDAVAVRYTARLNGLDALSLMKLDVLDGFEKIKICRAYEYKGMEIDYIPSDLENV
QPIYEEMDGWDKVFGIKDYDLLPENAKKYIARLEELAGVKVKYISTSPERDDTIIL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagcagatattattgtcggcattcaatggggcgatgaaggaaaaggtaaggta
gttgataaattatgtgaaaattatgattttgtttgcagaagtgcaggtggacacaatgca
ggacatacgatttgggtaaatggtgtaagatatgcgcttcatcttatgccaagtggagtt
ttgcatccaagatgtattaatattatcggaaatggagttgtggtttctcctgaagtattg
attgctgaaatggctcaatttgaaaatttaaaaggtagattatatatcagcgatagagct
catttaaatttaaaacatcattctttaatagacattgcaaaagaaaagctcaaaggcaaa
aatgccataggaacaacaggtaagggtataggaccttcttatgcagataagattaatcgt
acaggacatagagttggagagcttttagaaccacaaagactttgcgaggctttgataaaa
gattttgaagctaataaaactttttttgaaatgcttgaaattgaaattccaagtgctgaa
gaattgcttgctgatttaaaacgttttaatgaaattttaactccttatattacagatact
acaagaatgctttggaaggctttagatgaagataaaagagtacttttagaaggagctcag
ggctctatgcttgatattgatcatggaacttatccttatgttacaagttcaagtactatt
tcagcaggcgctttaacaggacttgggttaaatcctaaagaagcgggaaatattataggt
attgtaaaagcttatgcaacgcgtgtgggaaatggagcttttcctactgaggataagggc
gaagatggagaaaaaattgcgcaaattggaaaagagattggcgtaagcacgggacgcaaa
agacgctgtggatggtttgatgcggttgctgtaagatatacagcaaggcttaatggtctt
gatgctttatctttgatgaagcttgatgttttagatggttttgaaaagataaaaatttgt
cgtgcttatgaatataagggtatggaaatcgactatataccaagtgatttagaaaatgtt
caacctatttatgaagaaatggatggttgggataaagtttttggtataaaagattatgat
ttattgccagaaaatgctaaaaaatatatagcaagacttgaagagcttgcaggggttaag
gtaaagtatatttctactagccctgaaagagatgatactatcatcttatga

DBGET integrated database retrieval system