KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0225Help
Entry
CJJ81176_0225     CDS       T00461                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj00790  Folate biosynthesis
cjj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CJJ81176_0225 (folE)
Enzymes [BR:cjj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CJJ81176_0225 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF PHY
Motif
Other DBs
NCBI-ProteinID: EAQ73420
UniProt: A1VXS2
Position
195268..195840
Genome map
AA seq 190 aa AA seqDB search
MQKKFEDCVKTMLEIIGENPNREGLIKTPNRVFKTYEFLTSGYTQNVKEILNDALFESSN
NEMVLVRDIEFYSLCEHHLLPFFGRAHVAYIPNKKVVGLSKIPRLVEVFARRLQIQEQLT
EQIAQALMENVDAKGVGVVIEARHMCVEMRGVQKANSTTTTSALRGIFLKNEKTREEFFS
LINSAKQVRF
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaaaaaaatttgaagattgtgttaaaactatgcttgaaattataggagaaaatcca
aatcgtgaagggcttattaaaacaccaaatcgtgtttttaaaacttatgaatttcttact
agtggttatacgcaaaatgtcaaagaaattttaaatgacgctttatttgaaagctctaat
aatgaaatggttttagtgcgtgatatagaattttatagtctttgcgaacatcatctttta
cctttttttgggcgtgctcatgtagcctatattcctaataaaaaagtagtaggtttaagc
aaaattccacgccttgtagaggtgtttgcaagaagacttcaaatccaagaacaactcacc
gaacaaatcgcacaagctttaatggaaaatgtcgatgcaaaaggtgtaggtgtagtcata
gaagcaagacatatgtgtgttgaaatgcgtggagtgcaaaaagctaattcaaccactaca
acttcagctttgcgtggaattttcttgaaaaatgaaaaaaccagagaggaatttttttct
ctcataaactctgctaaacaggtaagattttaa

DBGET integrated database retrieval system