KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0828Help
Entry
CJJ81176_0828     CDS       T00461                                 

Definition
(GenBank) oxidoreductase, short chain dehydrogenase/reductase family
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:cjj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    CJJ81176_0828
Enzymes [BR:cjj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     CJJ81176_0828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: EAQ72336
UniProt: A0A0H3PA15
Position
759716..760495
Genome map
AA seq 259 aa AA seqDB search
MNTEFQGKTLVISGGTRGIGKAIVYEFAKVGANIAFTYNSNAQIADEMVQDLEKNYKIKA
RAYEFNILEPETYKELFEKIDVDFDRVDYFISNAIISGRAVVGGYTKFMKLKPKGINNIF
TATVNAFVVGAQEAAKRMEKVGGGSIISISSTGNLVYIENYSGHGTAKAAVEAMARYAAT
ELGEKNIRVNVVSGGPIETDALRAFTNYEEVKQATINLSPLNRMGQPEDLAGACLFLCSS
KASWVTGHTFIVDGGTTFK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagaatttcaaggaaaaactttagtgattagcggtggaactcgcgggataggc
aaagctatagtttatgaatttgctaaagtgggtgcaaatatagcttttacttataattct
aatgcgcaaattgctgatgaaatggttcaagatttggagaaaaattataaaatcaaagct
agagcttatgagtttaatatcttagaacctgaaacctataaagaactttttgaaaaaatt
gatgtggattttgatagagtggattattttatctcaaatgctatcatttcaggacgtgcg
gttgtaggtggctatactaaatttatgaagttaaaaccaaagggaattaataacattttt
acagccacagtaaatgcttttgttgtgggcgcacaagaagcagctaaaaggatggaaaaa
gtagggggtggaagcattatttctatctcatctacaggaaatttagtgtatatagaaaat
tattcaggtcatggtacagcaaaagccgctgtagaagctatggcaagatatgcggctact
gaacttggagaaaaaaatatccgtgtaaatgtcgtaagtggtgggcctattgaaactgat
gctttaagagcttttacaaattatgaagaagtaaaacaggctactataaatttaagccct
ttaaatcgcatggggcagcctgaagatttggctggagcatgtctttttctttgttcaagt
aaggcaagttgggtgacaggacatactttcatcgttgatggtggtacaacttttaaataa

DBGET integrated database retrieval system