KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_0833Help
Entry
CJJ81176_0833     CDS       T00461                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj00260  Glycine, serine and threonine metabolism
cjj00750  Vitamin B6 metabolism
cjj01100  Metabolic pathways
cjj01110  Biosynthesis of secondary metabolites
cjj01120  Microbial metabolism in diverse environments
cjj01230  Biosynthesis of amino acids
Module
cjj_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cjj00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJJ81176_0833 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CJJ81176_0833 (thrC)
Enzymes [BR:cjj01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CJJ81176_0833 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N CbiA
Motif
Other DBs
NCBI-ProteinID: EAQ72318
UniProt: A0A0H3PAQ5
Position
763190..764602
Genome map
AA seq 470 aa AA seqDB search
MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANLSYKDFALKLIESFG
FGEEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSE
FSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALDKDNLKV
FAIDEDFDAAQRTLKELLFSKDFQNEIKALNYELCAANSVNFGRILFQIIYHYYASLKLF
NEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYDLREKS
LKKTISPAMDILISSNIERLLFAKFKDKRTKELMNLLKNERYFKLEKEELQSLQEDFEAD
FCTDEECMQFIKQSKILIDPHTATCFKMLDPLKPSIITSTAEWTKFTPSMIKALYDRDSK
NEKEDLKFIAKEFNVQVKDEILALFDLKNSDEKVFEARNIKKEILDWMQK
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattggtcgagagtagaaatgtaaataatgtatcaagttttaaggaagctttgatt
aacccaaacgctccagaaggagggctttactcacctttaaatttgcctatttttgaagga
gaaaaatatgccaatttgtcttataaagattttgctttaaagcttatagaaagttttggt
tttggcgaagaagagctttttaaaaaggctttgaaaagttacgaaagctttgatgataaa
aatacacctatttctttgcaaaaaatctctgaaaaaacctatattaacgagctttggcat
gggcctacaagagcttttaaagatatggctttacagccttttggcgtgcttttaagcgaa
ttttcaaaggataaaaatattttaattatctgtgctacaagcggcgatacagggcctgca
accctaaaaagttttgaaaatgcaaaaaatgttaaagtagcttgtatgtatccaaaaggt
ggcacaagtggagttcaagagttgcaaatgcgagctttagataaggataacttgaaagtt
tttgccatagatgaggattttgacgcagcgcaacgcactttaaaagaattgcttttttca
aaagattttcaaaatgaaattaaagctttaaattatgagctttgcgcagctaattctgta
aattttgggcgtattttatttcagattatttatcattattatgcgagtttaaaacttttt
aatgagtttttagaagaagtacaaatcatcgttccaagtggaaattttggcaatgcttta
ggagctttttatgctaaaaaaatgggagctaaaatttcaaaaatcaaaatcgcttcaaac
gcaaataatattttgagtgaattttttaatcaaggcgtttatgatttgcgtgaaaaaagt
cttaagaagactatttctccagctatggatatacttatttcatctaatatcgaaagactt
ttgtttgcgaaatttaaagataaaagaactaaagaactgatgaatttgttaaaaaatgaa
agatattttaaacttgaaaaagaagaattacaaagtttgcaagaagattttgaggcggat
ttttgcaccgatgaagaatgtatgcaatttatcaaacaaagcaagattttaatcgatccg
cataccgcaacttgttttaaaatgcttgatcctttaaaacctagcattatcacttctaca
gcagaatggacaaaatttactccaagtatgataaaagctttatatgatagggattctaag
aatgaaaaagaagatttaaaatttatagctaaagagtttaatgtccaagttaaagatgaa
attttggctttatttgatttgaaaaatagcgatgaaaaggtatttgaagccagaaatata
aaaaaagaaattttagattggatgcaaaaatga

DBGET integrated database retrieval system