KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_1209Help
Entry
CJJ81176_1209     CDS       T00461                                 

Definition
(GenBank) phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Brite
KEGG Orthology (KO) [BR:cjj00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    CJJ81176_1209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 Flavi_NS4A
Motif
Other DBs
NCBI-ProteinID: EAQ72170
UniProt: A0A0H3PCZ1
Position
1123949..1125475
Genome map
AA seq 508 aa AA seqDB search
MQKDNLIAFVIFIISTIAFVIWGFGYISQHQLILFILASIFGIFMAFNIGGNDVANSFGT
SVGAKTVTIKQALIIAAVFELSGAIFAGAEVTKTIRSGIVIFPNSLDPMLFVIIMLAALL
SSGVWIFIATKKGLPVSTTHSIVGGIVGASIMMGLLKFDGIQTLSMVKWSEILRIAISWV
ASPLLGGIVAYIIYSYIDKKILKPSEKLNDDLKNIKKERKKFKEEYFLNLKTKSQEEQIK
ELSAIALDEEEQENNFYRNKMKEFKDQEKDIDIYSILKTHMPIIACIAAAIISAMFLFKG
LNNVSTLDILQNFWIIGIIGTISYVITFAIVKIVKKTELNKTTDRIFSWFQIFTASSFAF
SHGANDIANAIGPFAAILDVLKNGTINATSPVPFAALAMFGVALVVGLWFLGKEVITTVG
SKLATIRPTTGFSAELGASIVILLATQFGIPVSSTHILIGAILGIGVYNKNANWIMMKPI
GLAWIITLPAAGIMAALVFLGFKLSLGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacaacctcatagcttttgttatttttattatcagtactatcgcatttgtt
atttggggatttggttatatttcacaacatcaattgattctttttattcttgcttctata
tttggcatttttatggcatttaatataggtggaaatgatgtagccaattcttttggaaca
agcgttggcgcaaaaacagtaaccattaaacaagctttaattatagcagctgtttttgag
ctaagcggggcaatcttcgcaggcgcagaagttactaaaaccatacgcagcggtattgtt
atttttccaaattctttagatcctatgctttttgttatcattatgcttgctgcactttta
agctctggggtttggatttttattgcaaccaagaaaggcttacctgtatcaaccacgcac
agtatagttggtgggattgtaggtgctagtattatgatggggcttttaaaatttgatggg
atccaaacactctctatggttaaatggagcgaaattttaagaatagctatttcttgggta
gcttctcctcttttagggggtattgtagcttatattatttattcatatattgataagaaa
attttaaaaccatcagaaaaactaaatgatgatttgaaaaatatcaaaaaagaaagaaaa
aaattcaaagaagaatactttttaaatttaaaaacaaaatcccaagaagaacaaatcaaa
gaactttccgctatagctttggatgaagaagaacaggaaaataatttctatagaaataaa
atgaaggaatttaaggatcaagaaaaagatatagatatttactctattttaaaaactcat
atgccaatcattgcttgtattgctgctgctatcatttcggcaatgtttttatttaaaggt
ttaaataatgttagcactttggatattttacaaaacttttggattattggaattatagga
actataagttatgttataacatttgctatagtcaaaatcgttaaaaaaacagaacttaat
aaaaccactgatagaattttctcatggtttcaaatatttacagcctctagttttgcattt
tcacacggagccaatgatatagccaatgctataggtccttttgcagcgattttagatgtc
ttaaaaaacggcacaattaacgcgacttctcctgtaccttttgctgctttagctatgttt
ggagttgctctagttgtagggctttggtttttaggtaaagaagtgattactacagtgggt
tcaaaacttgcaaccatacgccctactactggattttctgcagaacttggtgcaagcata
gttatactcttagctacacaatttggaattcctgttagctccacccatatactcataggt
gctatattgggtataggagtgtataataaaaacgcaaattggattatgatgaagcctata
ggattggcttggattatcactttaccagccgctggtattatggcagcacttgtattttta
ggatttaaactatctttaggaatttaa

DBGET integrated database retrieval system