KEGG   Campylobacter jejuni subsp. jejuni 81-176: CJJ81176_pTet0037Help
Entry
CJJ81176_pTet0037 CDS       T00461                                 

Definition
(GenBank) cmgB9
  KO
K03204  type IV secretion system protein VirB9
Organism
cjj  Campylobacter jejuni subsp. jejuni 81-176
Pathway
cjj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cjj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CJJ81176_pTet0037
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cjj02044]
    CJJ81176_pTet0037
Secretion system [BR:cjj02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   CJJ81176_pTet0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CagX DUF4354
Motif
Other DBs
NCBI-ProteinID: EAQ71784
UniProt: A0A0H3PC96
Position
pTet:29176..30063
Genome map
AA seq 295 aa AA seqDB search
MKKIILINLLLCSFIWALNIPKTSTFDKRIAYAIYNANDVFQINAKNGYVSVLEFGTDER
IINTATGFAEGWDLIEKDNLLFIKPKAYKTQLVQQENNNIGESQASQEFVLDPNPHDWKT
NLIVITNLNTYVFDLKLVNQNNNATYKLSFSYPKKDLKAAKEFLEAQEQENIRRDLNKNT
IPRNWDFYMKINKGSEDISPNFAYDDGVFTYLGFDNTKTFPAVFMYDNGKESILNTHIKK
DGNYEVLVIQKITKQILLRSGDKVVGIFNRGYAKNPLDKTRETSNENIQREINKK
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataatcttgataaatttattgttgtgtagttttatttgggctttaaatatt
ccaaaaacttctacatttgataaaagaattgcttatgcaatttataatgcaaacgatgta
tttcaaattaatgcaaaaaatggctatgttagcgttttagaatttggtaccgatgaaaga
attatcaatactgctacaggttttgcagaaggttgggatttaattgaaaaagacaatctt
ttatttataaaacctaaagcttataaaacacaacttgttcaacaagaaaacaataatata
ggagagagtcaagcatcacaagaattcgttttagatccaaatcctcatgattggaaaact
aacctaattgttattacaaatctaaatacttatgtattcgatttaaaacttgtaaaccaa
aataataacgctacctataaactcagtttttcttaccctaaaaaagatttaaaagccgct
aaagaatttttagaagcacaagaacaagaaaatatacgcagagatttaaataaaaatacc
attcctagaaattgggatttttatatgaaaattaacaaaggtagcgaagacataagtcca
aattttgcttatgatgatggtgtttttacatatcttggttttgataatactaaaactttt
cctgctgttttcatgtatgataatggtaaagaaagtattttaaatactcatattaaaaaa
gatggcaattatgaagttttagtaattcaaaaaattactaaacaaatcttgttaagaagt
ggcgataaagtcgttggtatttttaatcgtggctatgcaaaaaatcctttagataaaaca
agagaaacctccaatgaaaatattcaaagagagataaataaaaaataa

DBGET integrated database retrieval system