KEGG   Corynebacterium jeikeium: jk0674Help
Entry
jk0674            CDS       T00255                                 

Gene name
panB
Definition
(GenBank) panB
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00770  Pantothenate and CoA biosynthesis
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    jk0674 (panB)
Enzymes [BR:cjk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     jk0674 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pantoate_transf PEP_mutase
Motif
Other DBs
NCBI-ProteinID: CAI36836
UniProt: Q4JWH1
Position
complement(810431..811291)
Genome map
AA seq 286 aa AA seqDB search
MNSMTATSGTSSSTPTGYLVPTKKVRIADLKARKGTGEPFAMLTAYDYSTAVAFAEAGVE
IMLVGDSAANVVFGYDATQRISMDEMVYLTAAVVRGAGNAAVVADLPFGTYEASDEQAVK
AASEMLHRTGAHAVKIEGGVRIADRIRAITDAGISVCAHIGFTPQSVNQLGGFKVQGRGA
GAEQLLADARAVQEAGADMVVLEMVPADVAASVTKELDIPTIGIGAGPDCDGQVLVWHDM
AAFPAGGHRPRFAKQWASVGSDLTAAAAAYKREVAEGGFPTQEHCF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcatgactgcaacatctggaacatctagctccacccccactggctacctggtc
cccaccaagaaggtgcgtatcgctgacttgaaggcgcgcaagggcacgggcgagccgttc
gcgatgctgaccgcctacgattactccaccgccgttgctttcgccgaggcgggcgtggag
atcatgttagtcggcgattctgccgcgaatgtggtgtttggttacgatgccacccagcgc
atcagcatggacgagatggtttacctgaccgcggccgtcgtccgcggagccggcaatgcc
gccgtggtcgctgacctgcccttcggcacctatgaggcctcggatgagcaggccgtgaag
gcggcttccgagatgctgcatcgcacgggcgcgcacgcggtgaagatcgaaggcggggtg
cggattgcggatcgcattcgcgctattactgacgccggcatctccgtctgtgcgcacatc
ggctttactccgcagtccgtcaaccagctgggcggtttcaaggtgcagggccgcggcgct
ggcgcagagcagctgctggccgatgcccgcgccgtgcaggaagccggtgccgacatggtg
gttctggaaatggtgcccgcagacgtggcggcttcggtgactaaggagctggacatcccg
acgattggcattggcgcaggtccggactgcgatgggcaggttctggtgtggcacgacatg
gctgcgttcccagccggcgggcaccgtccgcgcttcgctaagcagtgggcttcggtgggt
tcggacctgacagccgccgctgctgcctacaagcgagaggttgctgaaggcggattcccg
acgcaggagcactgcttctaa

DBGET integrated database retrieval system