KEGG   Corynebacterium jeikeium: jk0798Help
Entry
jk0798            CDS       T00255                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase beta chain (EC 4.2.1.20).,The beta subunit is responsible for the synthesis of L-tryptophan from indole and L-serine.
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00260  Glycine, serine and threonine metabolism
cjk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01130  Biosynthesis of antibiotics
cjk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cjk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    jk0798 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    jk0798 (trpB)
Enzymes [BR:cjk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     jk0798 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: CAI36960
UniProt: Q4JW47
Position
951210..952499
Genome map
AA seq 429 aa AA seqDB search
MTTEKTFKNADAQGKTLPTVGEILATATHHEPDERGHWGDFGGRYVPEALMAVIEEITDA
WAKARSDQGYLDQLDELHRTYTGRPSPLYYAARFSEAVGAEVWLKREDLNHTGSHKINNV
LGQVLLAKRMGKTRVIAETGAGQHGVATATACALLGIDCRIYMGAVDAERQALNIARMRL
LGAHVEVVEIGSRTLKDAINEAMRFWVSNADDTYYCFGTAAGPHPFPQMVRDLQRVIGVE
ARQQLLAETGKLPDAVVACVGGGSNAIGLFHPFIEDEGVDIVGAEAAGDGVETGRHAAPI
NLGLQGVFQGAFADLMQDEDGQIIESHSISAGLDYPGVGPEHSKLHAEGRARYLPITDSE
AMDGFKQLTLLEGIIPAIESSHAVAAAIKVAAEKPGSTLIVNISGRGDKDVNTAAKWFDM
LDQKSEKDG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgactaccgagaagaccttcaagaacgccgacgcgcaaggcaagaccctgccgacggta
ggcgagatcctggcgaccgccacccaccacgagcccgacgagcgcggacactggggtgat
ttcggtggccgctacgtccccgaggccctcatggccgtgatcgaggagatcaccgacgcc
tgggcgaaggcccgctcggaccaggggtacctggaccagctcgacgagctgcaccgcacc
tacaccggccgcccgtcgccgctgtactacgcggcccgcttctccgaggccgtgggcgca
gaggtgtggctgaagcgcgaggacctgaaccacaccggatctcacaagatcaacaacgtg
ctggggcaggtgctgctggccaagcgcatgggcaagactcgtgtgatcgcggagaccggc
gcaggccagcacggtgtggccacggcgacggcctgtgcgctgctcggcattgattgccgg
atctacatgggggccgtggacgccgaacggcaggccctcaacatcgctcgcatgcgcctg
ctcggtgcccacgtggaggtagtggagatcggctcccgcaccctgaaggacgccatcaac
gaggccatgcgcttctgggtttccaacgccgacgacacctactactgcttcggcaccgcc
gccggcccgcacccattcccgcagatggtgcgcgacctgcagcgcgtgatcggcgtggag
gcgcgccagcagctgctggccgaaaccggcaagctgcccgacgccgtagtggcctgcgtg
ggcggcggttccaacgcgatcggactgttccacccgttcatcgaggacgaaggcgtggac
atcgtcggcgctgaggccgcgggcgacggtgtagagaccggtcgccacgccgcgccgatc
aacctggggctgcagggcgtgttccagggggccttcgccgacctcatgcaggacgaggac
gggcagattatcgaatcgcactccatctccgccgggttggattacccgggcgtggggccg
gagcactctaagctgcacgctgaagggcgcgcccgctacctgccgatcaccgactccgag
gccatggatggcttcaagcagctgaccctcctggagggcatcatccccgccatcgagtcc
tcccacgcggtcgccgccgccattaaggtggccgcggagaagccgggatccacgctgatt
gtgaacatttccggccgcggcgacaaggacgtcaacacggctgcgaagtggttcgacatg
ctggatcagaagagcgagaaggacggctaa

DBGET integrated database retrieval system