KEGG   Corynebacterium jeikeium: jk0900Help
Entry
jk0900            CDS       T00255                                 

Gene name
menG
Definition
(GenBank) S-adenosylmethionine:2-demethylmenaquinone methyltransferase
  KO
K02553  regulator of ribonuclease activity A
Organism
cjk  Corynebacterium jeikeium
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cjk03019]
    jk0900 (menG)
Messenger RNA biogenesis [BR:cjk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Others
     jk0900 (menG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RraA-like
Motif
Other DBs
NCBI-ProteinID: CAI37064
UniProt: Q4JVU3
Position
complement(1077830..1078333)
Genome map
AA seq 167 aa AA seqDB search
MAEEKLTFIPTADLVDIIGSDVRSCDTQFRDLGGVVEFCGKITTVKCFQDNALLKSVLQE
DNPGGVLVIDGDASMHTALVGDIIAGLGKDHGWAGVVINGPIRDSKVIGQMEFGCKALGT
NPRKSTKTGEGERDVTVSFGGVDFIPGEYIYCDSDGIIVSDEIVQPV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagaaaaactgacttttattccgaccgccgacctggtggacatcattggcagc
gacgtgcgcagctgtgacacgcagttccgcgacttgggtggcgtggtggagttctgcggg
aagatcaccacggtgaagtgcttccaggacaatgcgctgctgaagagcgtgctgcaggag
gacaaccccggtggcgtgctggtgatcgacggtgatgcgtcgatgcacactgcactggtg
ggcgacattattgcgggcctgggcaaggatcacggttgggctggcgtggtgatcaacggg
ccgatccgtgattccaaggtgattggccagatggagttcggctgcaaggcgctgggcacc
aacccgcgcaagtccacgaagaccggcgagggcgagcgcgacgtgacggtgagcttcggc
ggcgtggactttatccccggcgagtacatttactgcgattcggacggcattatcgtttcc
gacgagattgtgcagccggtctaa

DBGET integrated database retrieval system