KEGG   Corynebacterium jeikeium: jk1282Help
Entry
jk1282            CDS       T00255                                 

Definition
(GenBank) putative polyhydroxybutyrate depolymerase
Organism
cjk  Corynebacterium jeikeium
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Esterase_phd Peptidase_S9 Abhydrolase_2 Esterase Hydrolase_4 DLH Abhydrolase_1 Abhydrolase_3 AXE1 BAAT_C
Motif
Other DBs
NCBI-ProteinID: CAI37451
UniProt: Q4JUQ6
Position
complement(1510283..1511371)
Genome map
AA seq 362 aa AA seqDB search
MQKFSSRFTHTKAANAHSFSAATHTDSVDSAVSGASCASRPARRGGRFRKLTLSLAVALG
IGAGTLAGPALDTAAGNESATPQASAAPNSLVGSLSGGVSGIAGALSPRPANNYQTFNVK
GKTRTAIVDVPVNSANRKKPILFVFGGRGQSAADMKNTSRLNAVAGRQAVIVHAEGIDRS
WEGAPYSKTRRGEDVAFVREMVRSLSKRYNVDTRRIYAAGLSNGGGMAMNLACQAPDLVA
GVVSVSGAYYDATMNNCRGRNVPTMLIHGVHDTLLHYGGGVLHGMHYYGARAAFDNAARR
NSCNMQTLHGAPAHALTSGFTYNGCRASTVLWRADFGGHNWHAFAPDAPQAAWHFLSRQR
HA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaaaattctcgtcacgttttactcacacgaaagccgcgaacgcccactctttttcc
gcggctactcacactgattctgtagattccgcagtttctggcgcttcctgtgcatcccgc
ccggctcgtcgcggtggccgtttccgcaagctcacactgtccctggctgtagcgctcggt
attggtgcaggcaccctggcaggcccggccctggacactgccgctggcaacgagtccgca
accccgcaggctagcgcggccccgaatagcctggtagggagcctctctggtggtgtcagt
ggtatcgctggtgccctgagcccgcgcccggcgaacaactaccagacctttaacgtcaag
gggaagacccgcactgcgattgttgacgttccggtgaactcggcgaaccgcaagaagccg
atcctctttgtgtttggcggtcgcggccaatctgcggcggacatgaaaaacacttcccgc
ctcaatgcggtggctggtcgccaggctgtcatcgtccacgcagagggtatcgaccgctcc
tgggagggggctccgtactccaagactcgccgtggcgaggacgttgcgttcgtccgcgag
atggtgcgttccctgtccaagcgctacaacgttgatacccgccgcatctatgcggccggc
ctgtccaatggtggcggcatggcaatgaacctggcttgccaggctccggatctggtcgcc
ggtgtcgtgtctgtttctggtgcttactatgacgccaccatgaacaactgccgtgggcgc
aacgtgccgaccatgctgatccacggtgtgcacgacactctgctgcactacggtggcgga
gtgctccacggtatgcactactacggcgcccgcgctgctttcgacaacgcagcacgccgt
aattcctgcaacatgcagaccctgcacggtgctccagcccatgccctgaccagcggattc
acctacaacggttgccgcgcttccaccgttctgtggcgggcggacttcggcggccacaat
tggcacgccttcgccccggacgctccgcaggctgcgtggcacttcctgtcgcgccaacgt
catgcctag

DBGET integrated database retrieval system