KEGG   Corynebacterium jeikeium: jk1469Help
Entry
jk1469            CDS       T00255                                 

Definition
(GenBank) hypothetical protein
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
cjk  Corynebacterium jeikeium
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    jk1469
Enzymes [BR:cjk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     jk1469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: CAI37642
UniProt: Q4JU65
Position
complement(1728756..1729664)
Genome map
AA seq 302 aa AA seqDB search
MSEKTSSADTQRYRLLAIHAHPDDESSKGAATMARYVDEGHRVKVLTCTGGERGDILNPE
MQELAEQGIGEMIEVRREEMAQAASILGVEHEWLGYVDSGLPEGDPKPPLPEGCFALEDT
DEVTQNVVRVVREFRPHVIITYDEYGGYPHPDHIKVHAVSVRAWEAAGDPNYHPELGEPW
EVKKLYYTHGFIRERFENLATAMYERGAQLPEQVLQHLEMWRQLPDIFSRVTTRVNVADW
FERRDDALRAHRTQIDPKGAFFLADMDLQKQVWPTEEFELAQSRVSSELPETELFAGLSE
AD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaaagacatcttccgcagatacgcagcgttatcgcttgttggcgattcatgcg
cacccggacgacgaatcgagcaagggtgcggccacgatggctcgttatgtcgacgagggg
caccgggtgaaggtactgacgtgcaccggtggtgaacgcggggacatcctgaacccagag
atgcaggaactggccgagcagggcatcggtgagatgattgaggtgcgccgcgaggagatg
gcccaggcggcttccatcttgggcgtggagcatgagtggctgggctatgtggattctggt
ctgccggagggtgatccgaagccgccgttgcccgagggatgttttgcactggaagacacg
gatgaggttacgcaaaacgtagtgcgagtggtccgtgagtttcgcccgcacgtcatcatc
acctacgacgagtacggcggttacccgcacccggatcacatcaaggtgcatgcggtttcc
gttcgtgcttgggaggctgccggcgatccgaactaccacccggagctgggcgaaccgtgg
gaggtaaagaagctctactacacccatgggttcattcgtgagcgctttgagaacctggct
actgccatgtatgaacgcggcgcgcagctgccggagcaggtcctgcagcacttggagatg
tggaggcagctgccggatattttttctcgagtgaccactcgcgtgaatgttgctgattgg
tttgaacgtcgcgatgatgcgttgcgtgctcaccgcactcagattgacccaaagggagct
ttcttcctggcggatatggacttgcagaagcaggtgtggccgaccgaggagttcgagctt
gcgcagtcgcgtgtgagcagcgagctgccagagacggaactcttcgccggtttaagcgag
gcagattag

DBGET integrated database retrieval system