KEGG   Corynebacterium jeikeium: jk1543Help
Entry
jk1543            CDS       T00255                                 

Gene name
fadA3
Definition
(GenBank) acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cjk  Corynebacterium jeikeium
Pathway
cjk00071  Fatty acid degradation
cjk00072  Synthesis and degradation of ketone bodies
cjk00280  Valine, leucine and isoleucine degradation
cjk00310  Lysine degradation
cjk00362  Benzoate degradation
cjk00380  Tryptophan metabolism
cjk00620  Pyruvate metabolism
cjk00630  Glyoxylate and dicarboxylate metabolism
cjk00640  Propanoate metabolism
cjk00650  Butanoate metabolism
cjk00900  Terpenoid backbone biosynthesis
cjk01100  Metabolic pathways
cjk01110  Biosynthesis of secondary metabolites
cjk01120  Microbial metabolism in diverse environments
cjk01130  Biosynthesis of antibiotics
cjk01200  Carbon metabolism
cjk01212  Fatty acid metabolism
cjk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cjk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    jk1543 (fadA3)
   00630 Glyoxylate and dicarboxylate metabolism
    jk1543 (fadA3)
   00640 Propanoate metabolism
    jk1543 (fadA3)
   00650 Butanoate metabolism
    jk1543 (fadA3)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    jk1543 (fadA3)
   00072 Synthesis and degradation of ketone bodies
    jk1543 (fadA3)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    jk1543 (fadA3)
   00310 Lysine degradation
    jk1543 (fadA3)
   00380 Tryptophan metabolism
    jk1543 (fadA3)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    jk1543 (fadA3)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    jk1543 (fadA3)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    jk1543 (fadA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cjk04147]
    jk1543 (fadA3)
Enzymes [BR:cjk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     jk1543 (fadA3)
Exosome [BR:cjk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   jk1543 (fadA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAI37716
UniProt: Q4JTZ1
Position
complement(1811770..1812963)
Genome map
AA seq 397 aa AA seqDB search
MTLQEDPKDIVVVGAARTPQGRMLGALAKKSAVDLGAETIKAVLERSGVSADAVDYVLMG
QVVQAGSGQNPAKQSAVAAGIPMNVPAMTVNKVCLSGLDAVINASRLIRLGDASIVVAGG
QESMTNAPHIAAGVRAGKGYGSLALQDSLERDGLSDPNEGTAMGLETDEGNAERGITREE
QDEIAARSHQLAEAATNEGVFNDEIVSIEVKGRKETVTVSTDEGIRSGTTAEGLAKLRPA
FVKDGTITAASASQISDGAAAVVLTTRENAEAKGLEILATLGEYGQTAGPDTKLHSQPSQ
ATAAALKKAGWEASDLDFLEINEAFASVVAQSIKDLDYPLEKTNIHGGGISLGHPIGASG
ARLVVHAAHELKRRGSGKAAVSLCGGGGQGDALLLWR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcaggaagacccgaaggacattgtcgttgtaggcgcagcacgcaccccgcag
gggcgtatgctcggcgcgctggcgaagaagagcgcggtcgatctgggcgcagagaccatc
aaggccgtgctggagcgttccggtgtgtcggcagatgccgtggattacgtgctgatgggc
caggttgtgcaggcgggctccggccagaacccggcgaagcagtccgccgtggccgcaggt
attccgatgaacgtccccgcaatgaccgtgaacaaggtatgcttgtccggcctggatgcc
gtgattaacgcctcccgcctgattcgcctgggtgacgcaagcattgtcgtcgccggtggt
caggaatccatgacgaacgccccgcacatcgccgcgggcgtgcgcgcgggcaagggctac
ggctccctggcactgcaggattccctggagcgagacggcctgtccgacccgaacgagggc
accgctatggggctggagaccgacgagggcaacgccgagcgcggcattacccgcgaggag
caggacgagattgcagctcgctcccaccagctggccgaggctgcgaccaacgagggcgta
ttcaacgacgagatcgtctccatcgaggtcaagggccgtaaggagacagtgaccgtctct
accgatgagggcatccgctccggcactaccgccgaggggctggcgaagctgcgtccggct
ttcgtgaaggacggcaccatcaccgccgcttctgcctcccaaatctccgacggtgcggca
gccgtggtgctgaccactcgcgagaacgctgaggccaagggcctggagatcctggccacc
ctgggcgagtacggccagactgccggcccggacaccaagctgcactcccagccgtcgcag
gccactgccgcggcgctgaagaaggcaggatgggaggccagcgacctggacttcttggag
atcaacgaggcctttgcttccgtggttgcacagtccatcaaggacctggattacccgctg
gagaagaccaacatccacggcggcggtatctccctgggccacccgatcggcgcttccggt
gctcgcctggtcgttcacgcggcgcacgagctgaagcgccgcggctccggcaaggctgcc
gtttccctctgtggcggcggcggtcagggcgacgcgctgctgttgtggcgctag

DBGET integrated database retrieval system