KEGG   Campylobacter jejuni subsp. jejuni M1: CJM1_0474Help
Entry
CJM1_0474         CDS       T01855                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cjm  Campylobacter jejuni subsp. jejuni M1
Pathway
cjm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cjm01100  Metabolic pathways
cjm01110  Biosynthesis of secondary metabolites
cjm01130  Biosynthesis of antibiotics
cjm01230  Biosynthesis of amino acids
Module
cjm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cjm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CJM1_0474 (trpC)
Enzymes [BR:cjm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CJM1_0474 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C AEP1
Motif
Other DBs
NCBI-ProteinID: ADN90688
Structure
PDB: 

Position
452631..453407
Genome map
AA seq 258 aa AA seqDB search
MILDKIFEKTKEDLKERKLKLPYDMLGRSLASNPFFPKDVIKALKRVEKEVKIIAEVKKA
SPSKGVIREDFDPLSIALNYEKNKAAAISVLTEPHFFKGSLEYLSLIRRYTQIPLLRKDF
IFDEYQILEALVYGADFVLLIAKMLSMKELKKLLEFARHLGLEALVEIHDKEDLSKAIFA
GADIIGINHRNLEDFTMDMSLCEKLIPQIPNSKIIIAESGLENKEFLEHLQNLGVDAFLI
GEYFMREKDEGKALKALL
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgatattggataaaatttttgaaaaaacaaaagaagatttaaaagaacgcaaactaaaa
cttccttatgatatgttagggcgttctttagcttcaaatcctttctttccaaaagatgtg
attaaagctttaaaaagagtagaaaaagaagttaaaatcatagcagaagtaaaaaaagca
agccctagcaagggagtcattagagaagactttgatcctttgagtattgctttaaattat
gagaagaacaaagctgcggcgatttctgttttgactgagccacatttttttaaaggttct
ttagaatacttaagtcttatacgccgttatacacaaattcctttacttagaaaagatttt
atctttgatgagtatcaaattttagaagctttggtttatggggcagactttgtattgtta
atcgctaaaatgctaagcatgaaagagcttaaaaaactgcttgagtttgcaagacattta
ggtcttgaggctttggttgaaattcatgataaagaggatttgagtaaggctatttttgct
ggagcggatattatcggtatcaatcatcgtaatttagaggattttactatggatatgagt
ttgtgcgaaaaacttatcccacaaatcccaaattcaaaaatcatcatcgcagaaagtggt
ttagaaaataaagaatttttagagcatttgcaaaatttaggcgttgatgcttttttaatc
ggcgaatattttatgcgcgaaaaagatgaaggaaaggctttaaaagctttgctttaa

DBGET integrated database retrieval system