KEGG   Campylobacter jejuni subsp. jejuni ICDCCJ07001: ICDCCJ07001_1411Help
Entry
ICDCCJ07001_1411  CDS       T01372                                 

Definition
(GenBank) ATP-dependent DNA helicase, UvrD/REP family
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
cjn  Campylobacter jejuni subsp. jejuni ICDCCJ07001
Pathway
cjn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cjn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    ICDCCJ07001_1411
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cjn03400]
    ICDCCJ07001_1411
Enzymes [BR:cjn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     ICDCCJ07001_1411
DNA repair and recombination proteins [BR:cjn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     ICDCCJ07001_1411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD_C UvrD-helicase UvrD_C_2 AAA_12 AAA_19 Viral_helicase1 PDDEXK_1 GST_C
Motif
Other DBs
NCBI-ProteinID: ADT66729
Position
complement(1446105..1448528)
Genome map
AA seq 807 aa AA seqDB search
MRVFALNLGLSSDFAMSEEKLDVREIFLKLLKKDELKDLAYYINLVDEKENFFNELEKFY
ENAYFQNLPKIPNPSKAYINKAYSELRSYCLGLTHVKNYKNLCDNFKSEVLDLSVFMQSS
FMTKFESTKYLQDLESTNLYFSAKRMELINALNTYAIELENYKIANLMNLLNHYSEAKNI
FHKDKNTLNFQDVSKKVYELITSEFKDMIYFRLDGFISHLLIDEFQDTSVIQYQILRPLI
AELVSGEGAKKNRTFFYVGDKKQSIYRFRKGKKELFDLLKQEFSQIKSDSLNTNYRSKEL
LVDFVNETFKEKIKDYKEQFALESKKGGFVRIVESKEQKVKNQAQEIKEKTLETLFEQIN
FLRSKNISYDDICILCWKNSDADMVLDFLREQKIPAFTQSNVLLENKASVRLVLEYAKYC
IFGDEFYLVFLKELLGFEPRKIALDFSKNAMENVLFLIKELKLDLNDIALIQFIEYAKTK
ENFLKLLFEPCALKIVSEQNMGISIMSVHKSKGLEFDHVILLDSLSKNNSNNEDIMLEYD
INQGWQLHIKDKIRELTKEPIYTLFKENITRANYEDDINKLYVAFTRAKESLIIIKRNEE
SVNGNYPSYFKGGFLNIHSQERGFLESKEQILSVKKESIQTLQKFEKISPQEVQSEEKLD
SKELYFGNTFHFFMQNLKLPKGENFQILTQRCKSKFRHFLDESDFEKLFKRIEILLKNTQ
FQNLIGDGKLLKEQALSFNGEIKQLDLLALKDEEAFIIDYKTGLAMQDKHKEQVRTYKIA
ISEILKKDKVHAFIVYCLENEIQILEI
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtgtttttgctttaaatttgggtttaagcagtgattttgcaatgagtgaagagaag
cttgatgtaagagagatttttttaaaacttcttaaaaaagatgaattaaaagatttggct
tattatattaatttagttgatgagaaagaaaatttttttaacgagcttgaaaaattttat
gagaatgcttattttcaaaatcttcctaaaattccaaatccatctaaagcttatatcaat
aaagcttatagtgagttaagaagttattgtttgggtcttactcatgtaaaaaattataaa
aacttgtgtgacaattttaaaagcgaagttttagatttatccgtgtttatgcaatcaagt
tttatgacaaaatttgaaagtacaaaatatttacaagatttagaaagcactaacttgtat
tttagcgcaaaaagaatggagcttataaatgctttaaatacttatgctatagagcttgaa
aattataaaattgctaatttaatgaatcttttaaatcattatagtgaagctaaaaatata
tttcataaagataaaaataccttaaatttccaagatgtgagtaaaaaagtttatgagtta
ataaccagtgaatttaaggatatgatttattttcgtttagatggctttatttcgcatttg
cttattgatgaatttcaagatacgagtgtgatccaatatcaaattttacgccctttgatc
gctgagcttgtttcaggagaaggggctaagaaaaatcgcacttttttttatgtaggagat
aaaaaacaaagtatttatcgctttcgtaaaggaaaaaaagaattatttgatttgttaaaa
caagaatttagtcaaattaaaagtgatagtttaaatactaattatcgttctaaagagctt
ttggttgattttgttaatgaaacttttaaagaaaaaatcaaagattataaagagcaattt
gccttagaaagtaaaaaaggcggttttgtgcgtattgtggaatctaaagaacaaaaggtt
aaaaaccaagcccaagaaatcaaggaaaagactttagaaactttatttgagcaaattaat
tttttaagatctaaaaatatttcttatgatgatatttgtattttgtgttggaaaaatagc
gatgcagatatggttttggattttttaagagagcaaaaaattcccgcatttactcaaagt
aatgttttgcttgaaaataaagcaagcgtaagacttgttttagaatatgctaaatattgt
atttttggcgatgagttttacttggtatttttaaaagaacttttaggttttgagcccaga
aaaatcgcccttgatttttcaaaaaatgctatggaaaatgtactttttttaataaaggaa
ttaaaacttgatttaaatgatatcgctttaatacaatttatcgaatatgctaaaactaag
gaaaattttttaaaacttttatttgagccttgcgctttgaaaatagtaagcgaacaaaat
atgggtattagtattatgagtgtgcataaatctaagggtttggaatttgatcatgtgatt
ttgctagatagtttatctaaaaacaattcaaacaatgaagatatcatgcttgaatatgat
atcaatcaaggttggcaactccatattaaagataaaattcgagagcttactaaagagcct
atttacaccctttttaaagaaaatattacaagagcaaattatgaagatgatatcaataaa
ctctatgtggcttttacaagagctaaggaaagtttgatcatcataaaaagaaatgaagaa
agtgtaaatggaaattatccaagttattttaaggggggatttttaaatatacattctcaa
gagagaggttttttagaaagcaaagaacaaattttaagcgttaaaaaagaaagcattcaa
actttgcaaaaatttgaaaaaattagcccacaagaagttcaaagtgaagaaaagcttgat
agtaaagagctatattttggaaatacttttcacttttttatgcaaaatttaaaactccct
aagggtgaaaattttcaaatacttactcaaagatgcaagagtaaatttagacatttttta
gatgagagtgattttgaaaagctttttaaaagaattgaaattttacttaaaaatactcaa
tttcaaaatttgattggtgatggaaagcttttaaaagaacaagctttgagttttaatgga
gaaattaaacaattagacttgcttgctttaaaagatgaagaagcttttataattgattat
aaaacaggtcttgctatgcaagataaacataaagagcaagtaagaacttataagatcgcc
attagtgaaattttgaaaaaagataaagtacatgcttttatagtttattgcttggaaaat
gaaattcaaattttggaaatataa

DBGET integrated database retrieval system